Recombinant Glycine max P24 oleosin isoform A

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
P24 oleosin isoform A; P89
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Protein Sequence
MTTQVPPHSVQVHTTTTHRYEAGVVPPGARFETSYEAGVKAASIYHSERGPTTSQVLAVL AGLPVGGILLLLAGLTLAGTLTGLAVATPLFVLFSPVLVPATVAIGLAVAGFLTSGAFGL TALSSFSWILNYIRETQPASENLAAAAKHHLAEAAEYVGQKTKEVGQKTKEVGQDIQSKA QDTREAAARDAREAAARDAREAAARDAKVEARDVKRTTVTATTATA
Uniprot No.

Target Background

Function
Plays a structural role in stabilizing lipid bodies during seed desiccation by preventing oil coalescence. It likely interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipase attachment during lipolysis in seedling growth.
Database Links

STRING: 3847.GLYMA19G13060.1

UniGene: Gma.226

Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.

Q&A

How does P24 oleosin isoform A differ structurally from isoform B?

While both isoforms share considerable sequence homology, P24 oleosin isoform A (226 aa, also known as P89) differs from isoform B (223 aa, also known as P91) in several key aspects:

FeatureIsoform A (P29530)Isoform B (P29531)
Length226 amino acids223 amino acids
Alternative nameP89P91
Key sequence differencesContains MTTQVPPHSVQVHTTTTHRY...Contains MTTVPPHSVQVHTTTHRY...
Hydrophobic domain variationsPLFVLFSPVLVPATVAIGLAVAGFLTSGAPLFIIFSPVLIPATVAIGLAVAGFLTSGV
C-terminal repeatsContains more AAARD repeatsContains fewer AAARD repeats

These structural differences likely contribute to their distinct immunological properties, as antibodies raised against one isoform do not cross-react with the other within the same species .

What is the molecular structure and function of oleosin proteins in plants?

Oleosins are structural proteins that stabilize oil bodies (lipid storage organelles) in plant seeds. The P24 oleosin isoform A features three distinct domains:

  • N-terminal hydrophilic domain: Variable in length and amino acid composition across species

  • Central hydrophobic domain: Highly conserved, contains approximately 72 amino acids forming an extended hairpin structure that penetrates the phospholipid monolayer and oil matrix

  • C-terminal amphipathic domain: Moderately conserved, interacts with the oil body surface

Functionally, oleosins prevent oil body coalescence during seed desiccation and germination by creating steric hindrance and electrostatic repulsion between adjacent oil bodies. The unique isoforms may contribute to species-specific oil body stability characteristics and influence mobilization of stored lipids during germination .

What expression systems are most effective for producing recombinant Glycine max P24 oleosin isoform A?

E. coli expression systems have proven most effective for producing recombinant P24 oleosin isoform A, based on current research protocols. The specific methodology includes:

  • Vector selection: pET expression systems with N-terminal His-tag for efficient purification

  • Host strain optimization: BL21(DE3) or Rosetta strains to handle codon bias

  • Expression conditions: Induction with 0.5-1.0 mM IPTG at 18-25°C for 16-20 hours minimizes inclusion body formation

  • Lysis conditions: Specialized buffers containing mild detergents (0.5-1% Triton X-100) facilitate solubilization of this hydrophobic protein

While E. coli remains the predominant expression system, research suggests that yeast expression systems may better accommodate post-translational modifications when these are required for specific functional studies .

What purification strategies maximize yield and purity of recombinant P24 oleosin?

Given the hydrophobic nature of P24 oleosin, standard purification protocols require modifications to maximize yield and purity:

Purification StepOptimized MethodologyTechnical Considerations
Immobilized Metal Affinity ChromatographyNi-NTA resin with gradient elution (20-250 mM imidazole)Include 0.1% detergent in all buffers to prevent aggregation
Size Exclusion ChromatographySuperdex 75/200 columnsRun at reduced flow rates (0.3-0.5 ml/min) to improve resolution
Ion Exchange ChromatographyQ-Sepharose for polishingCarefully optimize salt gradient based on isoelectric point

The purification process typically yields protein with greater than 90% purity as determined by SDS-PAGE. Researchers should be aware that yield optimization often requires balancing solubility with purity, particularly when working with this hydrophobic protein .

How can I verify the integrity and functionality of purified recombinant P24 oleosin?

Multiple analytical techniques should be employed to verify both structural integrity and functional properties:

  • SDS-PAGE analysis: Confirms molecular weight (approximately 24 kDa) and initial purity

  • Western blotting: Verifies identity using anti-His antibodies or specific anti-oleosin antibodies

  • Mass spectrometry: Confirms exact mass and sequence coverage

  • Circular dichroism: Assesses secondary structure elements, particularly important for confirming proper folding of the hydrophobic domain

  • Oil body binding assay: Functional verification through reconstitution experiments with phospholipids and triacylglycerols

For experiments requiring absolute confirmation of functionality, recombinant oleosin should demonstrate the ability to stabilize artificial oil bodies in an aqueous environment, which can be monitored through dynamic light scattering or microscopy techniques .

What are the optimal storage conditions for maintaining recombinant P24 oleosin stability?

Long-term stability of recombinant P24 oleosin requires careful attention to storage conditions:

FormPrimary StorageWorking StorageStability PeriodSpecial Considerations
Lyophilized-20°C to -80°CNot applicableUp to 12 monthsStore with desiccant
Solution-80°C4°C6 months at -80°C; 1 week at 4°CAdd 50% glycerol as cryoprotectant

Critical stability factors include:

  • Aliquoting to avoid freeze-thaw cycles (which cause significant degradation)

  • Using Tris/PBS-based buffer (pH 8.0) with 50% glycerol for frozen storage

  • Adding preservatives (0.02% sodium azide) for samples stored at 4°C

  • Protecting from light if fluorescently labeled

Research indicates that reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by the addition of glycerol to a final concentration of 50% before long-term storage .

How can oligomerization and aggregation of recombinant P24 oleosin be minimized during storage and experimental use?

The hydrophobic nature of P24 oleosin makes it prone to aggregation. To minimize this challenge:

  • Buffer optimization: Maintain pH between 7.5-8.5 and include low concentrations (0.05-0.1%) of non-ionic detergents such as Triton X-100 or n-dodecyl-β-D-maltoside

  • Temperature control: Maintain samples at 4°C during all handling steps; avoid room temperature exposure exceeding 30 minutes

  • Concentration management: Keep working concentrations below 1 mg/mL; higher concentrations increase aggregation risk

  • Additives: Consider adding 1-5% trehalose or sucrose as stabilizing agents for both lyophilized and solution forms

  • Microfiltration: Filter through 0.22 μm membranes immediately before experimental use to remove pre-formed aggregates

Regular quality control using dynamic light scattering can detect early signs of aggregation. If aggregation occurs, brief sonication (10-15 seconds) in a bath sonicator sometimes recovers monomeric protein, though with potential loss of structural integrity .

How can recombinant P24 oleosin be used in artificial oil body (AOB) construction for research applications?

Recombinant P24 oleosin enables the construction of artificial oil bodies (AOBs) through the following methodology:

  • Lipid preparation: Create a mixture of phospholipids (typically phosphatidylcholine) and triacylglycerols in chloroform

  • Film formation: Evaporate solvent under nitrogen to form a thin lipid film

  • Hydration: Add buffer containing purified recombinant P24 oleosin (0.5-2.0 mg/mL)

  • Emulsification: Subject the mixture to:

    • Sonication (10 cycles of 30s on/30s off at 40% amplitude)

    • High-pressure homogenization (15,000 psi, 5-10 passes)

    • Microfluidization (for more uniform size distribution)

  • Purification: Remove unemulsified components via centrifugation or density gradient separation

These AOBs serve as valuable models for studying:

  • Lipid body biogenesis and stability

  • Protein-lipid interactions

  • Delivery systems for hydrophobic compounds in research applications

  • Lipid mobilization during seed germination

The unique structural properties of P24 oleosin, particularly its hairpin conformation, are essential for proper AOB formation and stability .

What immunological techniques can distinguish between P24 oleosin isoform A and other oleosin variants?

Immunological differentiation between P24 oleosin isoform A and other variants requires specific approaches due to their similar properties:

  • Antibody selection: Use antibodies raised against the N-terminal region (amino acids 1-30) or C-terminal region (amino acids 190-226) of P24 oleosin isoform A, as these regions contain the greatest sequence divergence between isoforms

  • Immunoblotting optimization:

    • Use 15% polyacrylamide gels to achieve better separation of closely sized isoforms

    • Employ extended electrophoresis times (3-4 hours at 80V)

    • Consider using 2D electrophoresis (isoelectric focusing followed by SDS-PAGE) for enhanced separation

  • Epitope mapping: For precise isoform identification, perform epitope mapping using synthetic peptides corresponding to unique regions of each isoform

  • Cross-reactivity controls: Always include both isoforms A and B in immunological experiments to confirm specificity

Research shows that antibodies raised against one oleosin isoform do not cross-react with another isoform within the same species, making this approach highly specific when properly optimized .

How can site-directed mutagenesis of P24 oleosin be used to investigate structure-function relationships?

Site-directed mutagenesis provides valuable insights into P24 oleosin structure-function relationships through systematic modification of key domains:

  • Central hydrophobic domain modifications:

    • Proline-to-alanine substitutions to investigate the conserved proline knot structure

    • Hydrophobicity alterations to determine minimum requirements for oil body integration

    • Introduction of fluorescent probe attachment sites for dynamic structural studies

  • Terminal domain modifications:

    • Charge reversals to study electrostatic contributions to oil body stability

    • Truncation series to determine minimal functional domains

    • Chimeric constructs with isoform B segments to identify isoform-specific functions

A recommended experimental design includes:

  • Creating a panel of 8-12 strategic mutants across different domains

  • Expressing mutants in parallel under identical conditions

  • Evaluating oil body binding efficiency using fluorescence microscopy and co-sedimentation assays

  • Assessing oil body stability through coalescence assays under various stress conditions

These studies have revealed that the central hydrophobic domain's integrity is essential for proper membrane integration, while the terminal domains influence interactions with other oil body proteins and determine species-specific properties .

What are the critical parameters for successful reconstitution experiments with recombinant P24 oleosin?

Reconstitution experiments present significant challenges due to P24 oleosin's hydrophobicity. Key parameters for success include:

ParameterOptimal Range/ConditionImpact on Experiment
Protein:lipid ratio1:10 to 1:50 (w/w)Ratios above 1:10 ensure complete coverage; above 1:50 may cause multilayer formation
Buffer composition50 mM Tris-HCl, pH 7.5, 150 mM NaClMaintains protein stability while allowing lipid interactions
Detergent concentration0.05-0.1% during mixing, followed by controlled removalToo high: disrupts natural protein-lipid interactions; Too low: inadequate solubilization
Reconstitution methodDetergent dialysis or controlled dilutionGradual detergent removal promotes proper protein integration
Temperature25°C for mixing, 4°C for detergent removalHigher temperatures increase incorporation efficiency but risk aggregation

Common troubleshooting challenges include:

  • Protein precipitation during detergent removal (solution: reduce removal rate, add glycerol)

  • Incomplete incorporation (solution: optimize protein:lipid ratio, extend incubation time)

  • Heterogeneous vesicle formation (solution: extrusion through defined pore size membranes)

  • Loss of functionality (solution: verify protein integrity before reconstitution)

Researchers should validate successful reconstitution through freeze-fracture electron microscopy and functional binding assays .

How does post-translational modification affect P24 oleosin function, and how can this be studied using recombinant systems?

While native P24 oleosin undergoes post-translational modifications (PTMs), recombinant systems often lack these modifications, creating important research considerations:

  • Known PTMs in native P24 oleosin:

    • Phosphorylation at serine/threonine residues

    • Possible N-terminal acetylation

    • Disulfide bond formation in cysteine-containing variants

  • Strategies for studying PTM effects:

    • In vitro modification: Treat purified recombinant protein with appropriate kinases, acetyltransferases

    • Mass spectrometry: Compare modification patterns between native and recombinant proteins

    • Mutant construction: Create phosphomimetic mutants (S/T to D/E) or phosphodeficient mutants (S/T to A)

    • Alternative expression systems: Use eukaryotic hosts (yeast, insect cells) that provide more native-like modifications

  • Functional impact assessment:

    • Oil body stability assays comparing modified and unmodified proteins

    • Protein-protein interaction studies to identify PTM-dependent binding partners

    • Subcellular localization studies in plant expression systems

Research indicates that phosphorylation may regulate oleosin stability during seed germination, while other modifications might influence interactions with lipases and other oil body-associated proteins. Understanding these modifications is critical for accurately interpreting experiments using recombinant systems .

How do oleosin proteins from different plant species compare structurally and functionally?

Comparative analysis reveals important insights into oleosin evolution and specialization:

SpeciesMajor Oleosin IsoformsSize Range (kDa)Unique Structural FeaturesFunctional Specialization
Glycine max (soybean)P24 (A and B), P1818-24Extended C-terminal domain with AAARD repeatsEnhanced oil body stability during desiccation
Zea mays (maize)KD16, KD1816-18Shorter hydrophilic domainsSpecialized for high oil content seeds
Brassica campestris (rapeseed)KD2020Unique cysteine distributionAdapted to high-sulfur seed environment

Cross-species studies have revealed:

  • The central hydrophobic domain is highly conserved across species (>70% sequence identity)

  • Terminal domains show greater diversity and likely evolved to meet species-specific requirements

  • Antibodies can recognize oleosins across species boundaries, indicating conserved epitopes

  • At least two immunologically distinct classes of oleosins exist across diverse plant species

These comparative analyses provide valuable context for researchers working with P24 oleosin and help explain functional differences observed between recombinant proteins derived from different species .

How can synthetic biology approaches be used to engineer novel oleosin variants with enhanced properties?

Synthetic biology offers promising approaches for creating engineered oleosin variants:

  • Domain swapping: Exchange domains between isoforms or species to create chimeric proteins with novel properties

  • Consensus design: Generate synthetic oleosins based on consensus sequences from multiple species for enhanced stability

  • Minimal oleosin design: Identify and synthesize the minimal functional core required for oil body stabilization

  • Functionalization: Introduce novel functional domains for specialized applications:

    • Enzyme fusion for enhanced catalytic activity at oil-water interfaces

    • Affinity tags for targeted interaction studies

    • Stimulus-responsive domains for controlled release applications

Experimental design considerations include:

  • Maintaining the critical proline knot structure in the central domain

  • Preserving the amphipathic character of terminal domains

  • Validating oil body binding capacity of engineered variants

  • Assessing stability under various environmental conditions

These approaches have yielded variants with improved temperature stability, altered surface charge properties, and enhanced ability to stabilize different lipid compositions .

What are effective troubleshooting strategies for common challenges when working with recombinant P24 oleosin?

ChallengePossible CausesTroubleshooting Strategies
Low expression yieldToxicity to E. coli, codon bias, protein instability- Reduce induction temperature to 16-18°C
- Use Rosetta or BL21-CodonPlus strains
- Optimize codon usage for E. coli
- Try fusion tags (SUMO, Trx) to enhance solubility
Protein aggregation during purificationHydrophobic interactions, improper buffer conditions- Include 0.1-0.5% mild detergent in all buffers
- Add 5-10% glycerol to reduce aggregation
- Consider purification under denaturing conditions followed by refolding
- Reduce protein concentration during handling
Poor antibody recognitionEpitope masking, denaturation- Try multiple antibodies targeting different regions
- Modify Western blot conditions (reducing vs. non-reducing)
- Test native vs. denatured conditions in immunoassays
Inconsistent reconstitutionVariable lipid composition, suboptimal protein:lipid ratio- Standardize lipid sources and preparation methods
- Optimize protein:lipid ratios systematically
- Monitor reconstitution using multiple techniques (DLS, EM)

These troubleshooting approaches are based on compiled experience from multiple research groups and can significantly improve experimental outcomes when working with this challenging protein .

How can recombinant P24 oleosin be used as a tool for studying lipid metabolism in plants?

Recombinant P24 oleosin serves as a valuable tool for lipid metabolism research through several methodological approaches:

  • Competitive binding studies:

    • Use fluorescently labeled recombinant P24 oleosin to compete with native oleosin

    • Quantify displacement to assess binding site availability and lipid composition effects

    • Apply to different developmental stages to track dynamic changes in oil bodies

  • Interaction partner identification:

    • Employ recombinant P24 oleosin as bait in pull-down assays

    • Identify lipases and other oil body-associated proteins that specifically interact with P24

    • Map interaction domains through truncation and mutation analysis

  • In vitro lipid mobilization studies:

    • Reconstruct artificial oil bodies with defined lipid compositions

    • Add lipases with and without P24 oleosin to assess regulatory roles

    • Monitor lipid hydrolysis rates through colorimetric or chromatographic methods

  • Structural studies of lipid-protein interfaces:

    • Use NMR or X-ray crystallography with specifically labeled recombinant protein

    • Map the topology of protein integration into lipid monolayers

    • Determine how structural changes impact lipid accessibility

These methodologies have revealed that P24 oleosin not only stabilizes oil bodies but also regulates access of lipases to the stored triacylglycerols, suggesting an active role in controlling lipid mobilization during seed germination .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.