Recombinant Glycine max P24 oleosin isoform B

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Glycine max P24 Oleosin Isoform B

Recombinant Glycine max P24 oleosin isoform B is a protein derived from soybean (Glycine max) and produced through recombinant DNA technology . Oleosins are a class of lipid-associated proteins found in plant oil bodies, which are organelles that store lipids in seeds and other plant tissues . The P24 oleosin isoform B is a specific variant of the 24-kDa oleosin family . These proteins play a crucial role in the stability and structure of oil bodies .

Production and Isolation

Recombinant Glycine max P24 oleosin isoform B is produced using recombinant DNA technology, where the gene encoding the protein is inserted into a host organism (e.g., bacteria, yeast, or plant cells) to facilitate its expression and production .

Steps in Production and Isolation:

  1. Gene Cloning: The gene encoding P24 oleosin isoform B is isolated and cloned into an expression vector.

  2. Transformation: The expression vector is transformed into a host organism.

  3. Expression: The host organism is cultured under conditions that promote protein expression.

  4. Purification: The recombinant protein is isolated and purified using techniques such as affinity chromatography, ion exchange chromatography, or size exclusion chromatography.

Functional Properties and Research Applications

Oleosins, including P24 isoform B, are crucial for the stability of oil bodies in plant seeds . They prevent the coalescence of oil bodies by providing a steric barrier .

Functional Properties:

  • Oil Body Stabilization: Prevents oil body fusion

  • Emulsification: Acts as a natural emulsifier in plant seeds

  • Protein-Protein Interactions: Capable of forming dimers, trimers, or oligomers through interactions between N- and C-terminal domains

Oleosins and Oil Body Stability in Soymilk

Oleosins significantly affect the stability of oil bodies during soymilk production . Studies have shown that oleosins, particularly the 24-kDa isoform, prevent the decomposition of the C-terminal region .

Effect on Oil Body Stability:

  • Prevention of Coalescence: Oleosins maintain the discrete structure of oil bodies

  • Resistance to Proteolysis: The C-terminal domain of the 24-kDa oleosin is resistant to enzymatic degradation by papain

  • Surface Exposure: Oleosins are present on the surface of oil bodies and are susceptible to dissociation under certain conditions

Proteomic Analysis of Seed Maturation Proteins

Proteomic studies have identified and quantified various seed maturation proteins, including oleosins . These analyses provide insights into the relative abundance and characteristics of these proteins during seed development .

Table 1: Expression Analysis of Seed Maturation Proteins in Glycine max

EntryDescriptionMW (Da)pI (pH)PLGS scoreAmount (ng)% of TSP
Q9SEL0Seed maturation protein PM24 OS Glycine max17,7356.109168.431.500.65
Q9XER5Seed maturation protein PM22 OS Glycine max26,8244.978024.350.870.38
Q9LLQ6Seed maturation protein PM34 OS Glycine max16,6774.967963.370.610.26
C6T1Q7Putative uncharacterized protein OS Glycine max31,7466.687863.560.430.18
C6T588Putative uncharacterized protein OS Glycine max17,8125.957729.991.310.57
C6TK76Putative uncharacterized protein OS Glycine max41,5075.151249.910.130.06
C6TGM9Putative uncharacterized protein OS Glycine max22,3175.921194.810.110.05
A1KR24Dehydrin OS Glycine max25,3696.111148.550.800.35
C6T920Phosphoglycerate kinase Fragment OS Glycine max25,2969.711114.190.240.10
Q84V19Sucrose-binding protein 2 OS Glycine max55,7406.101069.190.300.13
C6SXU0Putative uncharacterized protein OS Glycine max27,7216.81295.300.230.10
C6SW7940S ribosomal protein S12 OS Glycine max14,7885.17249.560.090.04
P28551Tubulin b-chain Fragment OS Glycine max45,7215.55246.580.090.04
C6T7U2Putative uncharacterized protein OS Glycine max51,4625.25242.400.570.25
Q3980151 kDa seed maturation protein OS Glycine max50,9516.74239.270.240.10

This table illustrates the diversity and abundance of proteins present during seed maturation in Glycine max .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
P24 oleosin isoform B; P91
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-223
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Protein Sequence
MTTVPPHSVQVHTTTHRYEAGVVPPARFEAPRYEAGIKAPSSIYHSERGPTTSQVLAVVA GLPVGGILLLLAGLTLAGTLTGLVVATPLFIIFSPVLIPATVAIGLAVAGFLTSGVFGLT ALSSFSWILNYIRETQPASENLAAAAKHHLAEAAEYVGQKTKEVGQKTKEVGQDIQSKAQ DTREAAARDARDAREAAARDARDAKVEARDVKRTTVTATTATA
Uniprot No.

Target Background

Function
Plays a structural role in stabilizing lipid bodies during seed desiccation by preventing oil coalescence. It likely interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipase binding during lipolysis in seedling growth.
Database Links

KEGG: gmx:548081

STRING: 3847.GLYMA16G07800.1

UniGene: Gma.901

Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.