Recombinant Glycine max Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
ycf4
Target Protein Sequence
MSIIFRSDDVLIYSMAEVRRTSNLFWAVFTLLGSLGLLFVAISSYLGMDLFFISEKISDF SFIPDFIYFPFIPQGATMAFYGIAGLFSSFYFGSIIFWDIGGGFDIFNKKGKKVRFVRWG FPGKNRRIILEIPMNELHSIRIITEVKEEGIFTRTSTFESIVYLETIEQGFIPLTRIEDN LNGTQIAHKAGELSVFLGVPLFY
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Database Links
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of Ycf4 in photosynthetic organisms?

Ycf4 is a thylakoid protein that plays a crucial role in the assembly of photosystem I (PSI). It functions as a scaffold protein during PSI biogenesis, specifically in the second stage of assembly where it stabilizes an intermediate subcomplex consisting of the PsaAB heterodimer and the three stromal subunits PsaCDE. Additionally, Ycf4 facilitates the addition of the PsaF subunit to this subcomplex . Research in Chlamydomonas has shown that Ycf4 is essential for PSI assembly, with ycf4-deficient mutants being unable to grow photoautotrophically and displaying complete loss of PSI activity . Interestingly, while the photosystem subunits may be expressed normally in ycf4 mutants, the assembly of functional PSI cannot proceed without this protein .

How conserved is Ycf4 across different photosynthetic organisms?

Ycf4 shows significant conservation across photosynthetic organisms but with notable exceptions in legumes. The protein sequence:

  • Displays 41-52% identity between Chlamydomonas and other algae, land plants, and cyanobacteria

  • Is typically 184-185 amino acids in length across most photosynthetic organisms

  • Has undergone dramatic evolutionary changes in legumes:

    • Expanded to about 200 residues in soybean and Lotus japonicus

    • Reached extreme size of 340 residues in Lathyrus latifolius and Lathyrus cirrhosus

    • Shows greater sequence divergence within the single genus Lathyrus than between cyanobacteria and other angiosperms

    • Has been completely lost from the chloroplast genome in Lathyrus odoratus and three other groups of legumes

This unusual evolutionary pattern in legumes suggests that Ycf4 exists in a genomic mutation hotspot with a mutation rate estimated to be at least 20 times higher than elsewhere in the chloroplast genome .

What methods are effective for isolating and purifying Ycf4-containing complexes?

Successful isolation of Ycf4-containing complexes has been achieved through a combination of techniques:

  • Tandem Affinity Purification (TAP) approach:

    • Fusion of a TAP-tag to the C-terminus of Ycf4

    • Two-step affinity column chromatography:
      a) IgG agarose column binding using the Protein A domain of the TAP-tag
      b) TEV protease cleavage to remove Protein A

    • Overnight incubation in a rotating column at 4°C to improve adsorption efficiency (achieving 90% Ycf4 binding)

  • Successive fractionation methods:

    • Sucrose gradient ultracentrifugation

    • Ion exchange column chromatography

  • Recombinant expression systems:

    • E. coli expression systems for His-tagged versions of the protein

    • Lyophilization for storage with 6% trehalose in Tris/PBS buffer (pH 8.0)

For optimal results, researchers should verify Ycf4 stability after TAP-tagging through immunoblotting and confirm that the fusion does not affect PSI assembly or photosynthetic activity through fluorescence induction kinetics and growth assays .

How can researchers effectively disrupt the ycf4 gene for functional studies?

Several approaches have been employed for successful ycf4 disruption:

  • Biolistic transformation for chloroplast genome modification:

    • Use of chloroplast selectable marker cassettes (like aadA)

    • Complete removal of the ycf4 sequence is recommended over partial disruption, as contradictory results have emerged from studies using different disruption strategies

  • Verification of disruption:

    • RNA blot hybridization to confirm absence of transcripts

    • Western blotting with anti-Ycf4 antibodies

    • Fluorescence transient measurements of dark-adapted cells (ycf4-deficient transformants show continuous fluorescence rise rather than declining after maximum)

  • Phenotypic characterization:

    • Compare growth on acetate (heterotrophic) versus minimal (autotrophic) media

    • Test growth under different light intensities (particularly important as some ycf4 mutants show severe light sensitivity)

It is critical to note that contradictory results have been reported regarding photoautotrophic growth capabilities of ycf4 mutants. Some studies report partial photoautotrophic growth , while others found complete inability to grow photoautotrophically , suggesting that experimental conditions and the extent of gene disruption significantly influence outcomes.

How does Ycf4 interact with other assembly factors in the stepwise assembly of photosystem I?

Ycf4 functions within a coordinated network of four auxiliary factors that mediate the assembly of the PSI reaction center. Recent research has revealed the following sequential interactions:

  • Initial assembly stage: Ycf3 assists in the assembly of newly synthesized PsaA/B subunits into a reaction center subcomplex

  • Transfer stage: Y3IP1/CGL59 appears to facilitate the transfer of the RC subcomplex from Ycf3 to the Ycf4 module

  • Stabilization stage: Ycf4 receives and stabilizes the subcomplex

  • Protection stage: CGL71 may form an oligomer that transiently interacts with the PSI RC subcomplex, physically protecting it under oxic conditions until association with peripheral PSI subunits occurs

This stepwise assembly process involves multiple transient interactions that can be visualized through affinity purification followed by electron microscopy. The Ycf4-containing complex has been observed to measure approximately 285 × 185 Å, potentially representing several large oligomeric states .

What explains the contradictory findings regarding Ycf4 essentiality across different studies?

The contradictory findings regarding Ycf4 essentiality can be attributed to several factors:

These disparities highlight the importance of standardized methodologies and complete characterization when determining the essentiality of photosynthetic components.

How has the evolutionary pattern of Ycf4 in legumes impacted our understanding of chloroplast genome evolution?

The unusual evolutionary pattern of Ycf4 in legumes has provided several important insights into chloroplast genome evolution:

  • Localized hypermutation: The ycf4 region in Lathyrus shows a mutation rate at least 20 times higher than elsewhere in the chloroplast genome, challenging the common assumption that point mutation rates are approximately constant across a genome

  • Genomic instability and gene loss:

    • Each of the four consecutive genes ycf4-psaI-accD-rps16 has been lost in at least one member of the legume "inverted repeat loss" clade

    • This pattern of gene loss is exceptionally rare in angiosperm chloroplast genomes

  • Evidence for genome relocation:

    • The accD gene has relocated to the nucleus in Trifolium species

    • Nuclear copies of ycf4 or psaI were not found in Lathyrus despite their loss from the chloroplast genome

  • Minisatellite formation:

    • The ycf4 region in Lathyrus is a hotspot for formation and turnover of minisatellite sequences

    • In L. latifolius, the spacer between accD and ycf4 expanded to 648 bp due to multiple tandem repeat sequences (57-bp and 67-bp repeat units)

This case provides one of the few documented examples of sharply localized mutation rate acceleration in a specific region of a genome, violating the silent molecular clock hypothesis and suggesting that mutational processes can vary dramatically even within the same DNA molecule .

What are the optimal conditions for expression and purification of recombinant Ycf4?

Based on established protocols for recombinant Ycf4 production:

  • Expression system:

    • E. coli is the preferred expression system for full-length Ycf4 protein

    • His-tagging at the N-terminus allows for efficient purification

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using His-tag

    • Greater than 90% purity can be achieved as determined by SDS-PAGE

  • Storage conditions:

    • Lyophilized powder form is recommended for long-term storage

    • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for aliquoting and long-term storage at -20°C/-80°C

    • Working aliquots can be stored at 4°C for up to one week

    • Repeated freeze-thaw cycles should be avoided

  • Buffer composition:

    • Tris/PBS-based buffer with 6% trehalose, pH 8.0

How can researchers verify the functionality of recombinant Ycf4 in vitro?

To verify the functionality of recombinant Ycf4, researchers can employ several complementary approaches:

  • In vitro reconstitution assays:

    • Mix purified recombinant Ycf4 with isolated PsaA/B subunits and other PSI components

    • Monitor formation of PSI subcomplexes through size exclusion chromatography or blue native PAGE

  • Complementation studies:

    • Introduce recombinant Ycf4 into ycf4-deficient mutants

    • Assess restoration of:
      a) PSI activity through fluorescence measurements
      b) Photoautotrophic growth capabilities
      c) PSI complex accumulation via immunoblotting

  • Protein-protein interaction analyses:

    • Pull-down assays to verify interaction with PSI subunits (particularly PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF)

    • Co-immunoprecipitation with other assembly factors (Ycf3, Y3IP1, CGL71)

    • Surface plasmon resonance to determine binding affinities

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm proper protein folding

    • Thermal shift assays to evaluate protein stability

When evaluating functionality, it's important to consider that Ycf4 acts as part of a larger assembly pathway involving multiple auxiliary factors. Therefore, reconstitution of the complete assembly process may require the presence of additional factors like Ycf3, Y3IP1, and CGL71 .

How do structural differences in Ycf4 between species correlate with functional variations?

The structural differences in Ycf4 across species show interesting correlations with functional variations:

Species/GroupYcf4 Size (aa)Structural FeaturesFunctional Implications
Most photosynthetic organisms184-185Highly conserved structureEssential for PSI assembly
Soybean & Lotus japonicus~200Expanded protein sizeFunctional but with potential adaptation
Lathyrus latifolius & L. cirrhosus340Dramatically expanded sizeUnknown functional consequences; potentially adapted role
Lathyrus odoratusAbsentGene completely lostPSI assembly must occur through alternative mechanisms
Pea (Pisum sativum)PseudogeneNon-functional gene remnantPSI assembly must occur through alternative mechanisms
Desmodium (3 of 6 species)PseudogeneNon-functional gene remnantPSI assembly must occur through alternative mechanisms
Clitoria ternateaPseudogeneNon-functional gene remnantPSI assembly must occur through alternative mechanisms

These variations suggest that:

  • In species where Ycf4 has been lost or become non-functional, alternative proteins may have assumed its role in PSI assembly, potentially through nuclear-encoded factors

  • The expanded size in some legumes might represent:

    • Acquisition of additional functional domains

    • Relaxed selection allowing accumulation of non-functional sequences

    • Adaptation to different assembly requirements in these species

  • The extreme conservation in most photosynthetic organisms contrasted with rapid divergence in legumes suggests that Ycf4 may have specialized roles in different lineages

Despite these structural differences, the core function of Ycf4 in stabilizing PSI subcomplexes appears to be conserved where the protein remains functional, highlighting the evolutionary plasticity of photosynthetic assembly pathways.

What methodological approaches can resolve contradictions in Ycf4 research?

To resolve existing contradictions in Ycf4 research, several methodological approaches should be considered:

  • Standardized gene disruption:

    • Complete gene removal rather than partial disruption

    • Verification of complete absence of protein expression

    • Analysis of effects on neighboring genes due to Ycf4's location in a polycistronic transcriptional unit (rps9–ycf4–ycf3–rps18)

  • Comprehensive phenotypic characterization:

    • Testing growth under precisely defined conditions:

      • Multiple carbon source concentrations

      • Gradient of light intensities

      • Various growth media compositions

    • Quantitative measurements of PSI activity rather than qualitative assessments

  • Systematic comparative analysis:

    • Parallel studies across multiple species using identical methodologies

    • Particular focus on species where Ycf4 has been lost

    • Investigation of potential compensatory mechanisms in Ycf4-deficient species

  • Protein-protein interaction network mapping:

    • Identification of all interaction partners through techniques like BioID or proximity labeling

    • Comparison of interaction networks across species with different Ycf4 structures

  • Integration of genomic, transcriptomic, and proteomic data:

    • Analysis of expression patterns and potential co-regulation

    • Investigation of post-transcriptional regulation

    • Correlation of Ycf4 sequence variations with photosynthetic efficiency

By implementing these approaches, researchers can develop a more unified understanding of Ycf4's role in photosystem I assembly and resolve the apparent contradictions in current literature regarding its essentiality and functional mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.