Recombinant Glycine max Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Photosystem II

CP47 (psbB) is a core antenna protein that binds chlorophyll and β-carotene, facilitating excitation energy transfer to the PSII reaction center. Its roles include:

Key Functions

  • Pigment Binding: Binds 14 chlorophyll a molecules and β-carotene via histidine residues in transmembrane domains .

  • Structural Integrity: Forms the RC47 subcomplex with D1/D2 proteins and stabilizes the oxygen-evolving complex (OEC) .

  • Assembly: Interacts with low molecular mass (LMM) subunits (e.g., PsbH, PsbL) during PSII maturation .

Interactions in PSII

ComponentRole
D1/D2Forms reaction center with CP47; requires C-terminal processing .
PsbHStabilizes CP47-chlorophyll interactions during assembly .
PsbKBinds to CP43 and CP47, facilitating dimerization of PSII complexes .

Experimental Applications

ApplicationMethodOutcome
Pigment Binding StudiesRecombinant psbB reconstituted with chlorophyll a and β-carotene Validates chlorophyll coordination sites and energy transfer pathways.
Protein-Protein InteractionsCo-purification with PsbH/PsbL in E. coli Maps LMM subunit binding sites essential for PSII maturation.
Structural SimulationsQM/MM modeling of CP47 in cyanobacterial PSII Identifies red-shifted chlorophylls (B3, B1) and destabilized regions upon extraction.

Comparative Analysis with Other Organisms

Recombinant psbB from Glycine max shares structural homology with CP47 proteins in other species, such as Oenothera glazioviana (UniProt B0Z570) and Welwitschia mirabilis (UniProt B2Y1Y5) . Key differences include:

SpeciesUniProt IDSequence IdentityNotable Features
Glycine max (Soybean)Q2PMQ9N/AHis-tagged, full-length, glycerol-stabilized
Oenothera glaziovianaB0Z570~85% (with G. max)Lyophilized, 6% trehalose buffer
Welwitschia mirabilisB2Y1Y5~82% (with G. max)Anthoceros-like β-carotene binding motifs

Challenges and Future Directions

  • Structural Instability: Isolated CP47 refolds into non-native conformations, losing pigments like chlorophyll B1 and β-carotene h1 .

  • Functional Studies: Limited data on Glycine max psbB’s role in plant stress responses, contrasting with drought-related MYB factors .

  • Biotechnological Potential: Recombinant psbB could aid in engineering PSII with enhanced stability or altered excitation energy profiles .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them as requested.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGRIQS VNPAWGVEGFDPFVPGGVASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGHELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVIVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKKQVV
Uniprot No.

Target Background

Function
CP47, a component of the Photosystem II (PSII) core complex, binds chlorophyll and contributes to the primary light-induced photochemical processes of PSII. PSII acts as a light-driven water:plastoquinone oxidoreductase, harnessing light energy to extract electrons from water, generating oxygen and a proton gradient subsequently used for ATP production.
Database Links

KEGG: gmx:3989323

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the CP47 chlorophyll apoprotein and what is its role in Photosystem II?

CP47 is a core antenna protein of Photosystem II (PSII) that plays a crucial role in light harvesting and excitation energy transfer to the PSII reaction center. The protein is encoded by the psbB gene and functions as an integral component of the PSII core complex . CP47 contains multiple chlorophyll molecules that capture light energy and transfer excitation to the reaction center, where charge separation initiates the electron transfer cascade that drives photosynthesis .

Structurally, CP47 is characterized by histidine residues organized in pairs spaced by 13-14 amino acids within hydrophobic regions of the protein. These histidine residues are believed to be involved in chlorophyll binding . Experimental evidence demonstrates that intact CP47 is essential for functional PSII activity, as disruption of the psbB gene results in complete loss of PSII activity .

How does the amino acid sequence of CP47 influence its function in chlorophyll binding?

The amino acid sequence of CP47 exhibits high conservation across photosynthetic organisms, reflecting its critical functional importance. In particular, the presence of strategically positioned histidine residues in hydrophobic regions is fundamental to its role in chlorophyll binding . These histidine pairs, spaced by 13-14 amino acids, create specific microenvironments for coordinating chlorophyll molecules .

The hydropathy patterns of CP47 are highly conserved across species, with research comparing Synechocystis and spinach CP47 showing nearly indistinguishable patterns. This indicates consistent membrane folding architecture despite some sequence divergence (76% amino acid homology) . This conservation suggests that the three-dimensional arrangement of these amino acids creates optimal pockets for chlorophyll binding and proper orientation for efficient excitation energy transfer.

The conserved sequence regions that form the chlorophyll-binding pocket include:

RegionFunctionConservation
Histidine pairsChlorophyll bindingHighly conserved across species
Hydrophobic domainsMembrane integrationConserved folding pattern
Transmembrane helicesStructural stabilitySimilar hydropathy patterns

What methods are commonly used to express and purify recombinant CP47 protein for research?

Expression and purification of recombinant CP47 typically involves heterologous expression systems with careful consideration of the protein's membrane-associated nature. Based on established protocols for similar proteins, the following methodology is recommended:

  • Expression system selection: E. coli is commonly used for expression of recombinant photosynthetic proteins, as demonstrated with Welwitschia mirabilis CP47 .

  • Vector design: Construct expression vectors containing the full-length psbB gene (encoding amino acids 1-508 for many species) with appropriate tags for purification, such as N-terminal His-tags .

  • Protein extraction and solubilization: Careful membrane solubilization using detergents is critical for maintaining protein folding and function.

  • Purification strategy: Affinity chromatography using His-tag binding, followed by size-exclusion chromatography to isolate properly folded protein.

  • Storage conditions: Store purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0, with glycerol (final concentration 5-50%) added for long-term storage at -20°C/-80°C .

When reconstituting lyophilized protein, it is recommended to briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Repeated freeze-thaw cycles should be avoided to maintain protein integrity.

How can quantum mechanics/molecular mechanics (QM/MM) approaches be used to study chlorophyll excitation in CP47?

Advanced multiscale quantum mechanics/molecular mechanics (QM/MM) approaches provide powerful tools for studying the excitation energies of chlorophyll molecules in CP47. These methodologies are essential for understanding the mechanistic basis of light harvesting and energy transfer in photosynthetic systems.

Recent research has employed full time-dependent density functional theory with modern range-separated functionals to compute excitation energies of all CP47 chlorophylls within a complete membrane-embedded cyanobacterial PSII dimer . This approach quantifies the electrostatic effect of the protein environment on chlorophyll site energies, providing high-resolution quantum chemical excitation profiles of CP47 within a computationally complete model of "near-native" cyanobacterial PSII .

Key findings from such computational studies include:

  • The ranking of site energies differs from previous hypotheses, with chlorophylls B3 and B1 identified as the most red-shifted chlorophylls .

  • The distribution of excitation energies among the 16 chlorophyll molecules in CP47 provides critical insight into the pathways of excitation energy transfer to the reaction center .

  • The protein environment substantially influences chlorophyll excitation properties through electrostatic interactions, underscoring the importance of studying these pigments within their native protein context .

These computational methods complement experimental approaches and provide atomic-level insight into the electronic properties that underlie CP47 function in light harvesting and energy transfer.

What experimental approaches can reveal the structure-function relationship of histidine residues in CP47 chlorophyll binding?

Understanding the structure-function relationship of histidine residues in CP47 requires integrated experimental approaches targeting specific amino acid positions. Based on research findings, CP47 contains five pairs of histidine residues spaced by 13-14 amino acids in hydrophobic regions, strongly suggesting their involvement in chlorophyll binding .

A comprehensive experimental strategy should include:

  • Site-directed mutagenesis: Systematic replacement of histidine residues with non-coordinating amino acids to assess their specific contributions to chlorophyll binding and PSII function.

  • Spectroscopic analysis:

    • Circular dichroism to assess changes in protein secondary structure

    • Fluorescence spectroscopy to measure chlorophyll binding efficiency and excitation energy transfer

    • Time-resolved spectroscopy to quantify alterations in energy transfer kinetics

  • Functional assays: Oxygen evolution measurements to correlate structural modifications with functional outcomes in reconstituted systems.

  • Complementation studies: Introduction of mutated psbB genes into knockout lines to assess in vivo functional recovery.

Research has demonstrated that interruption of the psbB gene results in complete loss of PSII activity, confirming that intact CP47 is essential for functional PSII . This provides a sensitive background for assessing the functional impact of targeted histidine mutations.

How does CP47 interact with other components during the Photosystem II repair cycle?

The involvement of CP47 in the Photosystem II repair cycle is complex and involves interactions with several protein complexes. During PSII repair, CP47 remains associated with certain core proteins while others are replaced.

Research has revealed that CP47 participates in the formation of an intermediate complex known as RC47, which lacks the CP43 protein . This intermediate has been detected through immunoblot analysis using antibodies against PSII subunits, showing that D1 and D2 co-migrate with CP47 during gel electrophoresis, while CP43 does not .

The RC47 intermediate interacts with the FtsH protease complex during the repair cycle . This interaction is significant because:

  • FtsH is responsible for degrading damaged D1 protein, a critical step in the PSII repair cycle.

  • The interaction appears to be transient or weak, as evidenced by decreased co-purification of RC47 complexes after prolonged incubation with detergent .

  • Dephosphorylation of the D1 protein is a prerequisite for its degradation by FtsH during repair, and immunoblot analysis has shown that D1 in the RC47-FtsH complex is not phosphorylated .

This research suggests a model where RC47 serves as a repair intermediate that facilitates the degradation of damaged D1 by FtsH, with CP47 playing a structural role in maintaining the integrity of this repair complex.

ComplexComponentsFunction in Repair Cycle
PSII CoreD1, D2, CP47, CP43Functional photosystem
RC47D1, D2, CP47 (no CP43)Repair intermediate
FtsH-RC47FtsH protease + RC47Facilitates D1 degradation

What challenges exist in expressing functional recombinant CP47 from Glycine max compared to other species?

Expressing functional recombinant CP47 from Glycine max presents several unique challenges compared to other species, requiring specialized approaches for successful production and characterization.

Membrane protein expression is inherently challenging, and CP47 presents additional complexities due to its chlorophyll-binding properties and integration within the multi-subunit PSII complex. Specific challenges include:

  • Codon optimization: The psbB gene from Glycine max may contain plant-specific codon usage patterns that require optimization for heterologous expression systems.

  • Post-translational modifications: Plant-specific modifications may be essential for proper folding and function but might be absent in bacterial expression systems.

  • Chlorophyll incorporation: Functional CP47 requires proper incorporation of chlorophyll molecules, which is particularly challenging in non-photosynthetic expression hosts.

  • Protein stability: Maintaining the structural integrity of CP47 during purification requires careful detergent selection and buffer optimization.

Based on successful expression of recombinant CP47 from other species like Welwitschia mirabilis in E. coli , potential solutions include:

  • Using an N-terminal His-tag for efficient purification while minimizing interference with protein folding .

  • Employing specialized E. coli strains with enhanced membrane protein expression capabilities.

  • Optimizing growth conditions, including temperature reduction during expression to promote proper folding.

  • Utilizing lyophilization with stabilizing agents like trehalose (6%) to maintain protein integrity during storage .

How can antibody-based approaches be utilized to study CP47 in different plant species?

Antibody-based approaches offer powerful tools for studying CP47 in comparative plant biology research. Available antibodies against CP47 show cross-reactivity across multiple plant species, enabling comparative studies of PSII structure and function .

Immunological techniques applicable to CP47 research include:

  • Western blot analysis: For quantifying CP47 expression levels and detecting post-translational modifications or degradation products. This approach has been used to detect CP47 in various complexes during the PSII repair cycle .

  • Immunoprecipitation: For isolating CP47-containing complexes and identifying interacting proteins. This technique has revealed associations between CP47 and other components during PSII assembly and repair .

  • Immunolocalization: For determining the subcellular distribution of CP47 within chloroplast thylakoid membranes.

  • ELISA-based quantification: For high-throughput screening of CP47 levels across multiple samples or conditions.

Current antibodies demonstrate broad cross-reactivity across plant species, including Arabidopsis thaliana, Glycine max, Oryza sativa, Zea mays, and many others . This cross-reactivity stems from the high conservation of CP47 sequence across plant species and enables comparative studies across different photosynthetic organisms.

When selecting antibodies for CP47 research, it is important to consider the specific epitope recognized and the degree of conservation in the target species. For example, antibody PHY0058A shows cross-reactivity with CP47 from numerous species including Glycine max, while PHY0319 is specific to Arabidopsis thaliana .

What quality control measures should be implemented when working with recombinant CP47 protein?

Ensuring the quality and functionality of recombinant CP47 protein requires rigorous quality control measures throughout the experimental workflow. Based on established protocols for similar membrane proteins, the following quality control regime is recommended:

  • Purity assessment: SDS-PAGE analysis should confirm purity greater than 90% . Western blotting with specific anti-CP47 antibodies can verify protein identity.

  • Structural integrity verification:

    • Circular dichroism spectroscopy to confirm proper secondary structure

    • Size-exclusion chromatography to detect aggregation

    • Thermal stability assays to assess protein folding integrity

  • Functional characterization:

    • Chlorophyll binding assays to confirm pigment incorporation

    • Absorption and fluorescence spectroscopy to verify spectral properties characteristic of properly folded CP47

  • Storage stability monitoring:

    • Avoid repeated freeze-thaw cycles which compromise protein integrity

    • Store working aliquots at 4°C for no more than one week

    • For long-term storage, maintain at -20°C/-80°C in buffer containing 6% trehalose with 5-50% glycerol

  • Reconstitution protocol validation:

    • Brief centrifugation of protein vials before opening

    • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of glycerol to appropriate final concentration (usually 50%)

How can comparative genomics inform our understanding of CP47 evolution and function across plant species?

Comparative genomics approaches provide valuable insights into CP47 evolution and functional conservation across plant species. The psbB gene encoding CP47 shows significant sequence conservation, reflecting the critical role of this protein in photosynthesis.

Studies comparing psbB sequences between cyanobacteria and higher plants have revealed:

  • DNA sequence homology of 68% between cyanobacterium Synechocystis 6803 and spinach .

  • Higher conservation at the protein level, with 76% amino acid sequence homology .

  • Nearly identical hydropathy patterns despite sequence differences, indicating strong conservation of structural elements related to membrane topology and folding .

Methodological approaches for comparative genomics of CP47 include:

  • Multiple sequence alignment of psbB genes and CP47 proteins across diverse photosynthetic organisms, from cyanobacteria to higher plants including Glycine max.

  • Identification of conserved motifs, particularly those containing histidine residues involved in chlorophyll binding .

  • Phylogenetic analysis to trace the evolution of specific structural and functional domains.

  • Correlation of sequence conservation with functional importance through integration with structural and biochemical data.

  • Identification of species-specific variations that might reflect adaptation to different light environments or stress conditions.

The high degree of antibody cross-reactivity observed across multiple plant species further supports the conservation of key epitopes in CP47 , providing complementary evidence to sequence-based analyses.

What are the future research directions for CP47 in Glycine max and other crop species?

Future research on CP47 in Glycine max and other crop species will likely focus on integrating structural, functional, and applied aspects of this essential photosynthetic protein. Key research directions include:

  • High-resolution structural studies of species-specific CP47 variants to identify subtle differences that might influence photosynthetic efficiency under various environmental conditions.

  • Application of advanced computational approaches like quantum mechanics/molecular mechanics (QM/MM) to model excitation energy transfer in crop-specific CP47 variants .

  • Investigation of CP47's role in stress responses, particularly how structural modifications or damage to this protein contributes to photoinhibition under drought, temperature extremes, or high light conditions.

  • Exploration of natural variation in psbB genes across Glycine max cultivars and wild relatives to identify variants with enhanced photosynthetic performance or stress tolerance.

  • Development of crop improvement strategies targeting CP47 structure or abundance to enhance photosynthetic efficiency and yield potential.

  • Integration of CP47 research with broader photosynthetic engineering efforts aimed at increasing crop productivity and climate resilience.

  • Application of new protein design approaches using deep learning to engineer modified CP47 variants with enhanced properties6.

These research directions have significant implications for improving crop photosynthetic efficiency, productivity, and environmental stress tolerance, addressing critical needs in sustainable agriculture and food security.

How can understanding CP47 contribute to improving photosynthetic efficiency in crop plants?

Understanding CP47 structure and function offers several pathways to improve photosynthetic efficiency in crop plants, potentially enhancing yield and stress tolerance:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.