Recombinant Glycine max Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Definition and Role in Photosynthesis

The Photosystem Q (B) protein resides in the QB binding niche of PSII, facilitating electron transfer from the primary plastoquinone (QA) to the mobile plastoquinone (QB) . It stabilizes the QB molecule during the reduction process, ensuring efficient electron flow to the cytochrome b6f complex . In Glycine max, this protein is vital for maintaining photosynthetic efficiency under varying light conditions and herbicide exposure .

Table 1: Comparative Affinity of Herbicides for the QB Site in PSII

HerbicideI₅₀ (μM)Binding Specificity
Diuron0.01High affinity
Terbuthylazine0.03High affinity
Metribuzin0.05Moderate affinity
Bentazon50.0Low affinity
Data derived from fluorescence assays on pea thylakoids .

Recombinant Production and Applications

Recombinant production of Glycine max PSII proteins typically involves chloroplast-targeted expression systems. For example:

  • Expression Systems: Escherichia coli or chloroplast-transformed plants are used, leveraging vectors like pET or pGEX for high-yield production .

  • Purification: Affinity chromatography tags (e.g., His-tag) are employed, followed by size-exclusion chromatography to ensure native folding .

Table 2: Example Recombinant Protein Production Parameters

ParameterDetails
Host OrganismE. coli BL21(DE3)
VectorpET-28a(+)
Expression RegionMature peptide (58–302 aa)
Storage BufferTris-based, 50% glycerol
Adapted from recombinant phytol kinase protocols .

Functional Insights from Mutant Studies

Studies on PSII mutants in Arabidopsis and soybean reveal the QB protein’s role in stress resilience:

  • Low-Light Sensitivity: PsbQ-deficient mutants exhibit impaired electron transfer (QA⁻ → QB) and increased recombination rates, leading to photoinhibition .

  • Herbicide Resistance: Substitutions in QB-binding residues (e.g., Ser264→Gly) reduce diuron affinity, offering insights into herbicide-resistance engineering .

Research Gaps and Future Directions

Current limitations include the lack of a resolved 3D structure for soybean PSII and limited data on recombinant QB protein kinetics. Priorities for future research include:

  • Cryo-EM Studies: To map herbicide-binding interfaces in Glycine max PSII .

  • Redox Modulation: Investigating light-regulated disulfide bonds in recombinant QB protein stability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be finalized during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient. This gradient is subsequently utilized for ATP formation. PSII consists of a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Glycine max Photosystem Q(B) protein and what is its role in photosynthesis?

Glycine max Photosystem Q(B) protein, also known as Photosystem II protein D1 or 32 kDa thylakoid membrane protein, is a critical component of the photosynthetic machinery in soybean. This protein is encoded by the psbA gene and functions as part of Photosystem II (PSII), where it plays an essential role in the light-dependent reactions of photosynthesis .

Functionally, Photosystem Q(B) protein is involved in water splitting and quinone reduction processes. It uses energy from light to facilitate electron transfer in the photosynthetic electron transport chain. The protein contains binding sites for quinones and participates in charge separation events that are fundamental to converting light energy into chemical energy .

How do optimal storage conditions affect the stability and functionality of Recombinant Glycine max Photosystem Q(B) protein?

For optimal stability and functionality, Recombinant Glycine max Photosystem Q(B) protein should be stored at -20°C, and for extended storage, it should be kept at -20°C or -80°C. The protein is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized for protein stability .

Importantly, repeated freezing and thawing can significantly compromise protein integrity and should be avoided. For ongoing experiments, working aliquots can be safely stored at 4°C for up to one week . This approach minimizes protein degradation while maintaining experimental convenience.

The storage buffer composition (Tris-based with 50% glycerol) plays a crucial role in preventing protein aggregation and denaturation, which are common challenges when working with membrane proteins like Photosystem Q(B) .

What are the methodological considerations when studying electron transfer efficiency in Photosystem Q(B) proteins?

When studying electron transfer efficiency in Photosystem Q(B) proteins, researchers should consider several methodological approaches:

  • Isolated Membrane Preparation: Using isolated membranes rather than intact cells helps minimize physiological differences between strains and provides better experimental control. This approach reduces variables such as transmembrane electric field effects, uncontrolled redox states of the plastoquinone pool, differences in phycobilisome composition, and photoprotective mechanisms .

  • Fluorescence Decay Kinetics: Measuring fluorescence decay after flash excitation provides valuable information about forward electron transfer and charge recombination processes. This technique allows researchers to monitor QA- oxidation kinetics and distinguish between different electron transfer pathways .

  • Thermoluminescence Measurements: These measurements provide insights into charge recombination reactions and energy gaps between electron transfer components. Comparing thermoluminescence peak temperatures between different photosystems helps assess relative energy differences in electron transfer pathways .

  • Oxygen Evolution Measurements: Monitoring oxygen release patterns over sequential flashes helps assess the efficiency of water splitting and S-state turnover in the oxygen-evolving complex .

How can researchers effectively measure charge recombination in Photosystem Q(B) proteins?

Several complementary techniques are recommended for effectively measuring charge recombination in Photosystem Q(B) proteins:

  • Fluorescence Decay Analysis: Monitor fluorescence decay kinetics after a single turnover flash, which reflects the recombination of the charge-separated state. In the presence of DCMU (a QB-site inhibitor), this technique specifically measures S2QA- recombination .

  • Thermoluminescence (TL) Measurements: TL curves provide valuable information about the energetics of charge recombination pathways. The peak temperature of the TL emission correlates with the energy gap between the recombining charge pairs (e.g., S2QB- or S2QA-) .

  • Luminescence Decay Kinetics: Measuring luminescence decay after flash excitation at different temperatures (e.g., 10°C, 20°C, and 30°C) provides insights into the kinetics and temperature dependence of charge recombination processes .

  • Comparative Analysis: When studying recombination kinetics, it's valuable to compare results between different photosystem variants (e.g., Chl-a-PSII, Chl-d-PSII, and Chl-f-PSII) to understand how structural differences impact energetic constraints and recombination pathways .

How do energy limitations affect the function and resilience of Photosystem Q(B) proteins in far-red light conditions?

Energy limitations significantly impact Photosystem Q(B) protein function and resilience, particularly in far-red light conditions. Research comparing different PSII variants reveals:

  • Energy Constraints in Far-Red PSII Variants: Chlorophyll-d and Chlorophyll-f containing PSII variants operate with less energy input compared to Chlorophyll-a PSII, potentially increasing energetic constraints. Despite these limitations, these variants maintain comparable electron transfer efficiency from water to the plastoquinone pool .

  • Impact on Charge Recombination: Energy limitations alter charge recombination pathways. In Chl-d-PSII, there is a decreased energy gap between QA- and pheophytin, which favors recombination via the back-reaction route (P+Phe-), potentially increasing the formation of chlorophyll triplet states and singlet oxygen production .

  • Photodamage Sensitivity: Changes in recombination pathways affect photodamage susceptibility. Chl-d-PSII shows increased sensitivity to high light, reflecting its evolutionary adaptation to shaded epiphytic environments .

  • Radiative Recombination Differences: Both Chl-d-PSII and Chl-f-PSII exhibit higher luminescence than Chl-a-PSII, indicating increased radiative recombination, though the underlying mechanisms likely differ between the two photosystems .

What experimental approaches can distinguish between different electron transfer pathways in Photosystem Q(B) protein research?

Distinguishing between different electron transfer pathways in Photosystem Q(B) protein research requires sophisticated experimental approaches:

  • QA- Fluorescence Decay Analysis: By measuring chlorophyll fluorescence decay after a single turnover flash, researchers can distinguish between forward electron transfer (QA- to QB) and charge recombination pathways. The decay kinetics typically show multiple phases corresponding to different electron transfer events .

  • Inhibitor Studies: Using site-specific inhibitors like DCMU (which blocks electron transfer from QA- to QB) helps isolate specific electron transfer pathways. In the presence of DCMU, fluorescence decay primarily reflects charge recombination processes rather than forward electron transfer .

  • Temperature-Dependent Thermoluminescence: Different thermoluminescence peaks correspond to distinct recombination pathways (e.g., S2QA- or S2QB-). The peak temperature provides information about the energy barriers associated with these pathways .

  • UV Absorption Measurements: Following the absorption changes of the Mn-cluster in the UV region during S-state transitions provides insights into the efficiency of forward electron transfer from water to the plastoquinone pool .

What factors can lead to inconsistent results in fluorescence decay measurements of Photosystem Q(B) proteins?

Several factors can contribute to inconsistent results in fluorescence decay measurements:

  • Sample Heterogeneity: Presence of centers without a functional Mn-cluster can lead to non-decaying fluorescence components. For example, in studies with A. marina, some centers exhibited a non-decaying component attributed to centers where P+ is reduced by alternative electron donors that do not recombine in the minutes timescale .

  • Variable QB/QB- Ratio: Uncontrolled redox state of the plastoquinone pool can affect the QB/QB- ratio in dark-adapted PSII, leading to variability in fluorescence decay kinetics. Using isolated membranes rather than whole cells can help minimize this variability .

  • Inhibitor Binding Efficiency: Incomplete binding of inhibitors like DCMU can result in mixed kinetics, where some centers show forward electron transfer while others exhibit charge recombination. This is evidenced by the presence of a fast phase of small amplitude (5-6%) in some measurements .

  • Temperature Effects: The kinetics of charge recombination are temperature-sensitive, as demonstrated by luminescence decay measurements at different temperatures (10°C, 20°C, and 30°C). Maintaining consistent temperature conditions is crucial for reproducible results .

How can researchers address challenges in comparing different types of Photosystem II proteins?

When comparing different types of Photosystem II proteins (e.g., Chl-a-PSII, Chl-d-PSII, and Chl-f-PSII), researchers should address several key challenges:

  • Normalize Physiological Differences: Use isolated membranes rather than intact cells to minimize effects from physiological differences between strains. This approach helps control for variables such as transmembrane electric field, plastoquinone pool redox state, phycobilisome composition, and photoprotective mechanisms .

  • Account for Sample Variability: Include biological replicates and appropriate statistical analysis to assess the significance of observed differences. For example, while thermoluminescence measurements showed higher luminescence in Chl-f-PSII and Chl-d-PSII compared to Chl-a-PSII, the variability between replicates affected the statistical significance of differences between Chl-a-PSII and Chl-d-PSII in luminescence decay measurements .

  • Use Multiple Complementary Techniques: Employ various techniques to measure the same phenomenon. For instance, when studying charge recombination, combine fluorescence decay, thermoluminescence, and luminescence measurements to obtain a more comprehensive understanding .

  • Control Light Excitation Conditions: Ensure comparable excitation conditions when comparing different photosystems, particularly when studying far-red light-absorbing variants. Using both visible and far-red light excitation helps validate that observed differences are not artifacts of excitation conditions .

How do charge recombination pathways differ between Chl-a, Chl-d, and Chl-f containing Photosystem II proteins?

Charge recombination pathways show significant differences between the three types of Photosystem II proteins:

PSII TypeS₂QA⁻ RecombinationTL Peak TemperatureLuminescence IntensityProposed Mechanism
Chl-a-PSIIModerate rateHigherLowestLarger energy gap between QA⁻ and Phe
Chl-d-PSIIFaster rateLowerIntermediateSmaller energy gap between QA⁻ and Phe, favoring back-reaction via P⁺Phe⁻
Chl-f-PSIISlower rateSimilar to Chl-aHighestEnergy gap between QA⁻ and Phe similar to or larger than in Chl-a-PSII

The lower thermoluminescence temperature and faster luminescence decay for S₂QA⁻ recombination in Chl-d-PSII reflect a smaller energy gap between QA⁻ and pheophytin. This leads to increased recombination via the P⁺Phe⁻ pathway, potentially forming more chlorophyll triplet states .

In contrast, Chl-f-PSII exhibits slower S₂QA⁻ recombination measured by both fluorescence and luminescence decay, suggesting that the energy gap between QA⁻ and pheophytin is not greatly decreased or might even be larger than in Chl-a-PSII .

What are the implications of energy limitations in far-red Photosystem II variants for photodamage and photoprotection research?

The energy limitations in far-red Photosystem II variants have significant implications for photodamage and photoprotection research:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.