Recombinant Glycine max Probable phytol kinase 1, chloroplastic

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Glycine max Probable Phytol Kinase 1, Chloroplastic (UniProt ID: Q2N2K1) is a bacterially expressed protein derived from soybean (Glycine max). Phytol kinases catalyze the phosphorylation of phytol, a derivative of chlorophyll degradation, playing roles in lipid metabolism and chloroplast function. This recombinant variant is produced in E. coli for biochemical and structural studies, offering insights into chlorophyll recycling and chloroplast dynamics.

Production and Purification

  • Expression System: Escherichia coli .

  • Purity: >85% (verified via SDS-PAGE) .

  • Molecular Weight: Partial sequence; full-length molecular weight not specified in available data.

Research Applications

  • Enzymatic Assays: Study phytol phosphorylation kinetics and substrate specificity.

  • Protein Interaction Studies: Identify binding partners in chloroplast lipid metabolism.

  • Chloroplast Development: Investigate roles in chlorophyll homeostasis and stress responses (inferred from homologous systems in Arabidopsis ).

Limitations and Future Directions

  • Partial Sequence: The recombinant protein lacks full-length structure, limiting functional studies.

  • Uncharacterized Substrates: Phytol kinase substrates beyond phytol remain unexplored.

  • In Vivo Role: No mutant studies in soybean confirm its physiological role.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Probable phytol kinase 1, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
58-302
Protein Length
Full Length of Mature Protein
Species
Glycine max (Soybean) (Glycine hispida)
Target Protein Sequence
PGAGAEDLLYNAGATVGVLGGGYALVRAFDELTRRNILQQGLSRKLVHILSGLLFLVSWP IFSNSPKARYFAAFVPLVNCLRLLVNGLSLASDEGLIKSVTREGDPLELLRGPLYYVLIL ILSALVFWRESPIGVISLAMMCAGDGIADIIGRRYGSMKIPYNEHKSLAGSMSMLVFGFL VSIGMLYYYSVLGHVQLDWASTLPRVAFISFVATLVESLPITKVVDDNISVPLATMAVAF FTFHH
Uniprot No.

Target Background

Function
This recombinant Glycine max Probable phytol kinase 1 (chloroplastic) is involved in plant metabolism, specifically the activation and reutilization of phytol derived from chlorophyll degradation, including tocopherol biosynthesis. Its enzymatic function is the conversion of phytol to phytol monophosphate (PMP).
Database Links
Protein Families
Polyprenol kinase family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is Glycine max phytol kinase 1 and what is its role in plant metabolism?

Glycine max (soybean) phytol kinase 1 is a chloroplast-localized enzyme involved in the phosphorylation of phytol, a key step in tocopherol (vitamin E) biosynthesis. This enzyme plays an essential role in plant stress tolerance mechanisms, particularly under combined heat and high light conditions. The phytol kinase enzyme (also referred to as VTE5 in some literature) catalyzes the conversion of phytol to phytyl phosphate, which serves as a precursor for tocopherol synthesis . Tocopherols function as lipid-soluble antioxidants that protect photosynthetic membranes from oxidative damage during environmental stress. Mutants deficient in phytol kinase activity (vte5) show compromised chloroplast ultrastructure under stress conditions, including disorganized thylakoids and increased plastoglobule formation, indicating the critical role of this enzyme in maintaining chloroplast integrity .

How does phytol kinase 1 integrate into broader signaling networks in Glycine max?

Phytol kinase 1 in Glycine max functions within a complex signaling network that includes multiple stress response pathways. Research indicates interconnections between phytol kinase activity and mitogen-activated protein kinase (MAPK) cascades, with the latter being significant components of stress signaling in plants . Soybean contains 32 MAPKs, with nine specifically associated with defense responses . The MAPK signaling pathway (gmx04016) is among the prominent pathways activated in response to pathogen stress in soybeans . While direct interaction between phytol kinase and MAPKs has not been definitively established in the provided research, evidence suggests that phytol kinase activity influences downstream genes regulated by MAPK cascades, particularly those involved in prenyllipid metabolism and redox homeostasis. This integration allows for coordinated responses to multiple environmental stressors, including pathogen infection, heat, and high light conditions .

What distinguishes chloroplastic phytol kinase 1 from other kinases in the Glycine max proteome?

Chloroplastic phytol kinase 1 in Glycine max is distinct from other kinases in several key aspects:

  • Subcellular localization: As a chloroplast-targeted enzyme, it specifically functions within this organelle, unlike cytosolic or nuclear kinases.

  • Substrate specificity: Phytol kinase shows high specificity for phytol as a substrate, distinguishing it from broader-specificity kinases like MAPKs.

  • Metabolic function: While many kinases in Glycine max (such as the 32 identified MAPKs) primarily serve signaling functions , phytol kinase directly participates in metabolic pathways, specifically tocopherol biosynthesis .

  • Stress response role: Phytol kinase is particularly important for tolerance to combined abiotic stresses such as high temperature and high light, whereas many other kinases (like the defense MAPKs) are more specifically involved in biotic stress responses .

  • Domain structure: Unlike kinases with ankyrin-repeat (ANK) domains that facilitate protein-protein interactions (such as SAPK2 or MPK2) , phytol kinase has a structure optimized for its specialized metabolic function.

How is the expression of Glycine max phytol kinase 1 regulated under different stress conditions?

While the phytol kinase gene itself doesn't show dramatic transcriptional changes, several genes in related pathways are affected. For instance, the expression of 1-deoxy-D-xylulose-5-P synthase (DXS1), which supplies carbon to the plastidial isoprenoid pathway, is diminished under HL and HT+HL in both wild-type and vte5 mutants . This suggests that phytol kinase activity is regulated not only at the transcriptional level but also through substrate availability and interaction with other metabolic pathways.

Additionally, the expression of NDC1 (a plastoglobule-associated dehydrogenase) is remarkably upregulated in vte5 mutants under HT+HL conditions, possibly as a compensatory mechanism . This indicates that phytol kinase expression and activity are integrated into a broader regulatory network that responds to environmental stresses through multiple coordinated pathways.

What post-translational modifications affect phytol kinase 1 activity in Glycine max?

While the search results don't directly address post-translational modifications of phytol kinase 1 in Glycine max, they provide insights into potential regulatory mechanisms based on studies of other chloroplastic enzymes and kinases in soybeans.

Phosphorylation is likely a significant post-translational modification affecting phytol kinase activity. In Glycine max, many enzymes are targets of phosphorylation by various kinases, including MAPKs and serine/threonine protein kinases like SAPK2 . For example, Class II GmACBPs (acyl-CoA-binding proteins) are phosphorylated by GmMPK2 and GmSAPK2, affecting their function in lipid metabolism and stress responses .

The phosphoproteomics study mentioned in the search results revealed that multiple protein kinase families, including CK, CLK, CDK, and MPK, are capable of phosphorylating various proteins in soybeans under stress conditions . Given that phytol kinase functions in stress response pathways, it may similarly be regulated by phosphorylation events.

Additionally, redox-based modifications might regulate phytol kinase activity, especially considering its chloroplastic localization and role in responses to light and heat stress, which typically involve changes in cellular redox status .

What protein-protein interactions are critical for phytol kinase 1 function in chloroplasts?

Phytol kinase 1 likely interacts with other enzymes in the tocopherol biosynthetic pathway, particularly VTE1 (tocopherol cyclase), which is involved in redox cycling of tocopherol intermediates and plastochromanol-8 (PC-8) synthesis . The search results indicate that VTE1 expression is lower in vte5 mutants under stress conditions, suggesting a potential regulatory interaction between these enzymes .

The enzyme may also interact with components of plastoglobules, which are lipid-rich structures in chloroplasts that accumulate under stress conditions. Electron microscopy showed that plastoglobules increase in size and number in both wild-type and vte5 plants under stress, with more dramatic changes in vte5 mutants . This suggests that phytol kinase might interact with plastoglobule-associated proteins like phytol ester synthase (PES) mentioned in the search results .

Additionally, given the involvement of kinase cascades in stress responses, phytol kinase 1 may interact with or be regulated by other kinases, potentially including members of the MAPK family that are known to play roles in soybean stress responses .

What are the optimal conditions for expressing recombinant Glycine max phytol kinase 1 in heterologous systems?

For optimal expression of recombinant Glycine max phytol kinase 1 in heterologous systems, researchers should consider the following methodological approaches based on similar proteins studied in the search results:

Expression System Selection:

  • For protein-protein interaction studies, yeast expression systems have proven effective, as demonstrated by the successful use of yeast two-hybrid (Y2H) assays for studying interactions between GmACBPs and kinases .

  • For plant-based expression, Nicotiana benthamiana using Agrobacterium-mediated transient expression has been successful for bimolecular fluorescence complementation (BiFC) assays .

  • For biochemical studies requiring larger protein quantities, E. coli-based expression systems can be used with optimization of codons for bacterial expression.

Expression Construct Design:

  • Include appropriate targeting sequences if studying the fully functional chloroplastic form, or remove the chloroplast transit peptide for cytosolic expression in heterologous systems.

  • Consider using epitope tags (such as those used in the Western blot assays mentioned in search result ) for detection and purification.

  • For interaction studies, fusion constructs similar to those used for BiFC (nYFP and cYFP fusions) can be designed .

Expression Conditions:

  • For yeast expression, standard GAL4 system protocols have been successful for similar proteins .

  • For bacterial expression, lower temperatures (16-20°C) after induction may improve solubility of plant chloroplastic proteins.

  • Co-expression with chloroplast-specific chaperones might improve folding and functionality.

Purification Strategy:

  • Affinity chromatography using epitope tags (His, GST, etc.) followed by size exclusion chromatography.

  • Consider including stabilizing agents like glycerol and reducing agents in buffers to maintain enzyme activity.

  • For kinase activity assays, purification conditions should preserve phosphorylation capability, potentially requiring phosphatase inhibitors.

What are the most effective methods for assessing phytol kinase 1 activity in vitro and in vivo?

In Vitro Activity Assays:

  • Phosphorylation Assays: Similar to the in vitro kinase assay used for GmMPK2 and GmSAPK2 , researchers can develop assays using purified recombinant phytol kinase 1 with phytol substrate and radiolabeled or non-radioactive ATP.

  • Phos-tag SDS-PAGE Analysis: This technique, mentioned in search result , allows for the separation of phosphorylated and non-phosphorylated proteins and could be adapted to monitor phytol phosphorylation by detecting the phosphorylated product.

  • HPLC or LC-MS Analysis: These methods can quantify the conversion of phytol to phytyl phosphate and subsequent metabolites in the tocopherol biosynthetic pathway.

In Vivo Analysis Methods:

  • Transgenic Complementation: As shown with vte5 mutants , introducing the recombinant phytol kinase gene into deficient plants can demonstrate functional activity through restoration of phenotypes.

  • Metabolite Profiling: Analysis of tocopherol, plastoquinone, and other prenyllipid compounds in plants with modified phytol kinase expression can provide insights into in vivo activity .

  • Stress Response Phenotyping: Measuring physiological parameters like chloroplast ultrastructure (using electron microscopy as in search result ), photosystem efficiency, and stress tolerance in plants with altered phytol kinase levels.

  • Bimolecular Fluorescence Complementation (BiFC): This technique, used in search result for protein interaction studies, can be adapted to visualize phytol kinase interactions with other proteins in the tocopherol biosynthetic pathway in vivo.

How can researchers effectively analyze the impact of mutations on phytol kinase 1 structure and function?

Structural Analysis Methods:

Functional Analysis Methods:

  • Site-Directed Mutagenesis: Creating specific mutations in the recombinant protein to study structure-function relationships.

  • Enzyme Kinetics: Comparing kinetic parameters (Km, Vmax, kcat) between wild-type and mutant enzymes to quantify effects on catalytic efficiency.

  • Complementation Studies: Similar to the overexpression and RNAi approaches mentioned for defense genes in search result , expressing mutant versions of phytol kinase in vte5 plants to assess functional rescue.

  • In Planta Phenotyping: Examining stress responses in plants expressing mutant phytol kinase under conditions like high light and high temperature that reveal vte5 phenotypes .

  • Protein-Protein Interaction Analysis: Using Y2H and BiFC methods as described in search result to determine if mutations affect interactions with other proteins in the biosynthetic pathway.

Data Analysis Approaches:

  • Comparative Transcriptomics: Similar to the analysis in search result , transcriptomic profiling can reveal broader impacts of phytol kinase mutations on gene expression networks.

  • Metabolomics Integration: Correlating changes in metabolite profiles (especially tocopherols) with specific mutations to understand functional implications.

How does phytol kinase 1 contribute to Glycine max tolerance to combined abiotic stresses?

Phytol kinase 1 plays a crucial role in Glycine max tolerance to combined abiotic stresses, particularly high temperature and high light (HT+HL), through several interconnected mechanisms:

  • Tocopherol Biosynthesis: Phytol kinase (VTE5) catalyzes a key step in tocopherol synthesis, converting phytol to phytyl phosphate. Tocopherols serve as important lipid-soluble antioxidants that protect photosynthetic membranes from oxidative damage during stress .

  • Chloroplast Membrane Integrity: Research using electron microscopy has revealed that under HT+HL stress conditions, vte5 mutants (deficient in phytol kinase) exhibit severely compromised chloroplast ultrastructure compared to wild-type plants. The mutants show diminished and scattered thylakoids, increased numbers of plastoglobules, and areas containing amorphous material . This indicates that phytol kinase activity is essential for maintaining chloroplast membrane integrity during stress.

  • Redox Homeostasis: Phytol kinase influences the redox state of the cell by contributing to the pool of tocopherols and other prenyllipids with antioxidant properties. The accumulation of α-tocopherol quinone (α-TQ) in vte5 mutants under stress conditions suggests insufficient redox cycling capacity, which would normally be supported by adequate levels of tocopherols .

  • Metabolic Adaptation: Under stress conditions, plants redistribute their metabolic resources. Phytol kinase contributes to this adaptation by facilitating the conversion of phytol (released from chlorophyll during stress-induced degradation) into bioactive compounds that support stress responses rather than allowing potentially phototoxic free phytol to accumulate .

  • Signaling Integration: While not directly demonstrated for phytol kinase, the search results indicate that kinase-mediated signaling pathways are important in stress responses. For example, MAPK signaling is a prominent pathway activated in response to stress in soybeans . Phytol kinase likely integrates with these signaling networks to coordinate comprehensive stress responses.

What is the relationship between phytol kinase 1 activity and pathogen defense responses in Glycine max?

The relationship between phytol kinase 1 activity and pathogen defense responses in Glycine max involves several interconnected mechanisms:

  • Metabolic Intersection with Defense Pathways: While phytol kinase primarily functions in tocopherol biosynthesis, its metabolic products intersect with defense-related pathways. The search results indicate that phenylpropanoid biosynthesis, flavonoid biosynthesis, and isoflavonoid pathways are significantly enriched in response to pathogen infection in soybeans . These secondary metabolite pathways can be influenced by the redox status of the cell, which is partly regulated by tocopherols produced through the phytol kinase pathway.

  • MAPK Signaling Integration: The MAPK signaling pathway (gmx04016) is identified as a prominent pathway in soybean response to the pathogen Corynespora cassiicola . Given that plants often integrate different stress response pathways, phytol kinase may interact with or be regulated by components of the MAPK cascade during combined abiotic and biotic stress responses.

  • Transcriptional Networks: Research on defense MAPKs in Glycine max identified 309 genes that are increased in their relative transcript abundance by all 9 defense MAPKs, with 71 of those genes having measurable amounts of transcript in Heterodera glycines-induced nurse cells undergoing a defense response . While phytol kinase is not specifically mentioned among these genes, the metabolic pathways involving tocopherols may be part of the broader transcriptional reprogramming during pathogen defense.

  • Hormone Signaling: Plant hormone signal transduction (gmx04075) is another significant pathway in soybean pathogen responses . Hormones like jasmonic acid and salicylic acid regulate both abiotic stress tolerance and pathogen defense. Phytol kinase activity, by influencing redox homeostasis through tocopherol synthesis, may indirectly affect hormone signaling pathways that coordinate defense responses.

  • Cellular Redox Status: Tocopherols produced via the phytol kinase pathway serve as antioxidants that can influence cellular redox status, which is a critical factor in pathogen recognition and defense signaling. Maintaining appropriate redox balance is important for both abiotic stress tolerance and effective immune responses.

How does phytol kinase 1 interact with the broader prenyllipid metabolism network in chloroplasts?

Phytol kinase 1 serves as a critical node in the broader prenyllipid metabolism network within chloroplasts, connecting multiple metabolic pathways through the following interactions:

  • Tocopherol Biosynthesis Pathway: Phytol kinase (VTE5) catalyzes the phosphorylation of phytol to phytyl phosphate, which is subsequently converted to phytyl-diphosphate by phytyl-phosphate kinase (VTE6). This provides a key precursor for tocopherol synthesis, linking phytol recycling to the production of these essential antioxidants .

  • Chlorophyll Degradation Integration: During leaf senescence or stress-induced chlorophyll degradation, phytol is released from chlorophyll. Phytol kinase provides a metabolic route to recapture this phytol, preventing its accumulation to potentially toxic levels and redirecting it to tocopherol synthesis .

  • Plastoglobule Association: The search results indicate that under stress conditions, plastoglobules (lipid-rich structures in chloroplasts) increase in number and size, particularly in phytol kinase-deficient (vte5) plants . Plastoglobules are sites of prenyllipid metabolism, including tocopherol synthesis and storage, suggesting that phytol kinase activity influences plastoglobule formation and function.

  • Metabolic Feedback Regulation: The activity of enzymes in related pathways appears to be coordinated with phytol kinase function. For example, in vte5 mutants under stress conditions, expression of VTE1 (tocopherol cyclase) is lower than in wild-type plants, while NDC1 (a plastoglobule-associated dehydrogenase involved in phylloquinone and plastoquinone metabolism) is upregulated . This suggests metabolic feedback regulation among different branches of prenyllipid metabolism.

  • Broader Isoprenoid Pathway Connections: Phytol kinase indirectly connects to the broader isoprenoid pathway through shared precursors and regulatory mechanisms. The search results mention that under stress conditions, the expression of DXS1 (1-deoxy-D-xylulose-5-P synthase), which supplies carbon to the plastidial isoprenoid pathway, is diminished . Despite this, prenyllipids (except α-tocopherol in vte5 mutants) were unchanged or increased under combined HT+HL stress, indicating complex regulatory interactions within the network.

How can structural insights into phytol kinase 1 be leveraged for enzyme engineering?

Advanced enzyme engineering of Glycine max phytol kinase 1 can be approached through several strategies based on structural insights:

  • Rational Design Based on Protein Modeling: While the search results don't provide specific structural information about phytol kinase 1, they mention the use of the HDOCK server for predicting protein-protein interactions . Similar computational approaches could be used to model phytol kinase structure, identifying critical catalytic residues and substrate binding sites for targeted modifications. Engineering efforts could focus on:

    • Increasing catalytic efficiency by modifying active site residues

    • Enhancing substrate specificity

    • Improving thermal stability for better function under heat stress

  • Domain-Swapping Approaches: Based on the importance of specific domains in protein-protein interactions (like the ANK domain mentioned for GmACBPs ), researchers could explore domain-swapping experiments with phytol kinase 1. This could involve:

    • Creating chimeric enzymes with domains from related kinases to alter substrate preference or regulatory properties

    • Introducing domains that enhance protein stability under stress conditions

    • Engineering interaction domains to facilitate association with other components of the tocopherol biosynthetic pathway

  • Targeting Post-Translational Modification Sites: The search results discuss phosphorylation sites prediction using databases like GPS 6.0, EPSD 1.0, and NetPhos 3.1 . Similar approaches could identify potential modification sites in phytol kinase 1 for engineering:

    • Modifying phosphorylation sites to create constitutively active or regulatable versions

    • Altering sites involved in redox regulation for enhanced stress tolerance

    • Engineering sites that affect protein-protein interactions or subcellular localization

  • Directed Evolution Approaches: Complementing computational and rational design methods with directed evolution could yield improved phytol kinase variants:

    • Developing high-throughput screening methods based on tocopherol production or stress tolerance

    • Creating libraries of phytol kinase variants through error-prone PCR or DNA shuffling

    • Selecting variants with enhanced performance under specific stress conditions that match agricultural challenges

What are the current challenges in studying the phosphorylation targets of phytol kinase 1?

Studying the phosphorylation targets of phytol kinase 1 presents several significant challenges:

  • Substrate Specificity Determination: While phytol kinase is known to phosphorylate phytol, comprehensive characterization of its substrate range presents challenges:

    • Distinguishing between primary biological substrates and in vitro phosphorylation capabilities

    • Identifying potential alternative substrates under different physiological conditions

    • Developing sensitive analytical methods to detect phosphorylated products in complex plant extracts

  • Technical Limitations in Phosphorylation Detection: The search results mention the use of Phos-tag acrylamide SDS-PAGE for detecting phosphorylated proteins , but such methods present challenges when applied to small molecule substrates like phytol:

    • Need for specialized analytical techniques such as LC-MS/MS for detecting phosphorylated prenyllipids

    • Distinguishing enzymatic phosphorylation from non-enzymatic or chemical phosphorylation

    • Quantifying phosphorylation rates in the presence of competing reactions in vivo

  • Chloroplast Localization Complexities: The chloroplastic localization of phytol kinase 1 adds several challenges:

    • Difficulty in isolating intact chloroplasts without disrupting native enzyme-substrate interactions

    • Recreating the chloroplast environment for in vitro studies

    • Distinguishing between phosphorylation events occurring in different chloroplast subcompartments (stroma, thylakoid membranes, plastoglobules)

  • Overlapping Enzymatic Activities: Plants often have redundant or overlapping enzymatic activities:

    • Determining the specific contribution of phytol kinase 1 versus other kinases that might phosphorylate phytol

    • Distinguishing primary from secondary effects in mutant studies

    • Accounting for compensatory pathways that may mask phenotypes

  • Dynamic Regulation Under Stress: As indicated by the differential responses under various stress conditions :

    • Capturing transient phosphorylation events during stress responses

    • Understanding how different stresses affect substrate availability and enzyme activity

    • Determining how phosphorylation patterns change during stress acclimation and recovery

What emerging technologies are most promising for elucidating the roles of phytol kinase 1 in chloroplast lipid homeostasis?

Several emerging technologies show significant promise for advancing our understanding of phytol kinase 1's roles in chloroplast lipid homeostasis:

Comparative Analysis of Phytol Kinase Expression and Activity Under Different Stress Conditions

Stress ConditionPhytol Kinase ExpressionTocopherol LevelsPlastoglobule FormationChloroplast UltrastructureKey Metabolic Changes
ControlBaseline expressionNormal levelsFew, small plastoglobulesOrganized thylakoids, normal starch granulesBalanced prenyllipid metabolism
High Light (HL)Similar to control with some regulatory adjustmentIncreased α-tocopherol in WT, limited in vte5Increased number/size, non-osmiophilic rings in vte5Large starch granules, otherwise normalDXS1 expression diminished, affecting isoprenoid pathway
High Temperature (HT)Regulated to support stress responseModerately increased in WTLarge plastoglobules with non-osmiophilic ringsHighly stacked thylakoidsSimilar gene expression patterns in WT and vte5
Combined HT+HLComplex regulation with differential expression of related genesSignificantly increased in WT, reduced in vte5Numerous in vte5, often without non-osmiophilic ringsWT: disorganized, swollen thylakoids. vte5: diminished, scattered thylakoids, amorphous materialNDC1 upregulated in vte5, VTE1 expression lower in vte5 than WT

Predicted Kinase-Specific Phosphorylation Sites on Proteins Related to Prenyllipid Metabolism

ProteinKinase FamilyPredicted Phosphorylation SitesFunctional DomainPotential Impact on Enzyme ActivityDetection Method
Class II GmACBPsAGC, CKMultiple sites (38 total phosphosites)ANK domainAltered protein-protein interactionsGPS 6.0, EPSD 1.0, NetPhos 3.1
VTE1 (Tocopherol cyclase)CK, MPKNot specifically detailedCatalytic domainModified enzymatic activity or stabilityPredictions based on similar proteins
NDC1 (Plastoquinone dehydrogenase)CLK, CDKNot specifically detailedFAD-binding domainAltered redox cycling activityPredictions based on similar proteins
DXS1 (1-deoxy-D-xylulose-5-P synthase)Multiple familiesNot specifically detailedThiamin diphosphate binding domainChanged carbon flux to isoprenoid pathwayBased on phosphoproteomics studies
Phytol Kinase 1Potentially MPK, SAPKBased on structural similarity to other kinase targetsATP-binding domain, substrate binding siteModified catalytic efficiency or substrate specificityPrediction based on similar proteins

Impact of Genetic Modifications on Phytol Kinase Pathway and Plant Stress Tolerance

Genetic ModificationEffect on Tocopherol LevelsImpact on Stress ToleranceChloroplast PhenotypesMetabolic ConsequencesReference
vte5 knockout/mutationReduced α-tocopherol synthesisCompromised tolerance to combined HT+HL stressSeverely affected ultrastructure under HT+HLAccumulation of α-TQ, reduced PC-8 levels
VTE1 overexpressionEnhanced tocopherol cyclingImproved oxidative stress toleranceNot specifically detailedImproved redox homeostasisInferred from
Defense MAPK overexpressionIndirect effects through signalingEnhanced pathogen resistanceNot specifically detailedIncreased transcript abundance of 309 defense-related genes
RNAi of defense genesIndirect effects through defense pathwaysIncreased susceptibility to nematode parasitismNot specifically detailedAltered defense response
NDC1 modificationAffects plastoquinone redox stateImpacts electron transport and ROS managementNot specifically detailedChanges in prenylquinone metabolismInferred from

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.