Recombinant Glycine receptor subunit beta-type 4 (ggr-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ggr-1; gbr-4; C09G5.1/C09G5.9; Glycine receptor subunit beta-type 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-473
Protein Length
Full Length of Mature Protein
Species
Caenorhabditis elegans
Target Names
ggr-1
Target Protein Sequence
QAEFWDYDENVTQIEEDFKIDDVTRILKRVGNYNRNAYPLLDQDLATHVDIQMYIEGMSS FHAQSMDFQVDIYFQEKWVDHRLQHNNTKRILVKDPKLFGLLWHPDLYFANARTASFHDV TQPNFLVWIYPNGTVWYDCRISLTVLCMQDLARYPLDSQNCGLRILSYAYDEEQLIIRWN GGNPVEVNRGIRMPDMHLKHIKFYTKRDKYATGIWSSAVAEFHVDREITHHIIQSYIPTS LIVIISWFSFWLDVEAVPGRVSLSITTLLTLATQSSAARMALPQASDVKAIDVWMGTCMA FVFSAMIEFTVVNYCVRRKVRTKIKPRGLSEQVHDMVAQYREKKDKFNNGNCEISYEMAL QPNEDNATVQRNFEKKEVREMNQASLFVRRSLLPTSKRKTIEDRINRVEENRKNAQKIDR YSRALFPLAFIIFNIFYWIYYLKYAGSNSPELLL
Uniprot No.

Target Background

Function

Glycine receptors are ligand-gated chloride channels. Channel opening is initiated by extracellular glycine, contributing to the generation of inhibitory postsynaptic currents.

Database Links

KEGG: cel:CELE_C09G5.1

STRING: 6239.C09G5.1

UniGene: Cel.25057

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Glycine receptor (TC 1.A.9.3) subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell junction, synapse. Cell membrane; Multi-pass membrane protein.

Q&A

What is Glycine Receptor Subunit Beta-Type 4 (ggr-1) and how does it compare to other glycine receptor subunits?

Glycine Receptor Subunit Beta-Type 4 (ggr-1) is a subunit of inhibitory glycine receptors found in Caenorhabditis elegans, encoded by the ggr-1 gene (also known as gbr-4). The protein consists of 473 amino acids with distinctive structural elements including transmembrane domains and a cys-cys loop typical of pentameric ligand-gated ion channels .

Unlike mammalian glycine receptors which are primarily composed of alpha and beta subunits, the C. elegans ggr-1 represents an evolutionary variant. Mammalian GlyRs are pentameric structures with stoichiometries such as α₃:β₂, while the C. elegans receptors may have different subunit compositions .

The ggr-1 protein contains several key domains that define its function:

  • An N-terminal signal peptide

  • Four transmembrane domains (M1-M4)

  • A large intracellular loop between M3 and M4

  • Cys-cys loops critical for proper folding and ligand binding

This structural arrangement is consistent with other members of the ligand-gated ion channel superfamily but contains specific sequence variations that differentiate it from mammalian glycine receptor subunits .

What are the structural and functional relationships between ggr-1 and mammalian glycine receptor beta subunits?

Though from different species, ggr-1 shares important structural similarities with mammalian GlyR beta subunits. In mammals, the beta subunit is crucial for receptor clustering at synapses through its interaction with gephyrin, a scaffolding protein. This interaction occurs via a binding motif located in the cytoplasmic loop between the third and fourth transmembrane segments .

Key functional parallels include:

FeatureMammalian GlyR βggr-1 (C. elegans)
Primary FunctionStructural role in receptor complexPresumed similar structural role
Gephyrin Binding18-residue segment in intracellular loopPotential homologous binding region
Receptor TraffickingEssential for synaptic localizationLikely involved in receptor localization
Ligand BindingDoes not directly bind glycinePresumed similar non-binding role

How can researchers effectively express and purify recombinant ggr-1 for experimental studies?

For successful expression and purification of recombinant ggr-1, researchers should follow these methodological steps:

  • Vector selection: Choose expression vectors with strong promoters suitable for the host system (bacterial, yeast, or mammalian cells). For ggr-1, mammalian expression systems like HEK293 cells often provide proper folding and post-translational modifications.

  • Construct design: Include appropriate tags for purification and detection. The commercially available recombinant ggr-1 is supplied in a Tris-based buffer with 50% glycerol, suggesting this formulation maintains protein stability .

  • Expression optimization:

    • Temperature: Often lower temperatures (16-30°C depending on system) increase proper folding

    • Induction time: Typically 24-48 hours for mammalian systems

    • Media supplements: Consider adding ligands or chaperone-inducing agents

  • Purification strategy:

    • Initial capture: Affinity chromatography using the fusion tag

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

  • Storage conditions: Store at -20°C or -80°C with 50% glycerol to prevent freeze-thaw damage. For working solutions, maintain aliquots at 4°C for up to one week .

When designing expression constructs, researchers should note that the full-length ggr-1 protein spans amino acids 20-473, and should include the complete sequence to ensure proper folding and function .

How do researchers investigate ggr-1 interactions with scaffolding proteins compared to mammalian glycine receptor studies?

Investigating ggr-1 interactions with scaffolding proteins requires specialized approaches that build upon methods used for mammalian GlyR studies. For mammalian GlyRs, the beta subunit interaction with gephyrin is critical for receptor clustering at synapses .

Methodological approaches:

  • Overlay assays: These can identify direct binding between ggr-1 and potential scaffolding partners. This technique successfully identified the 18-residue gephyrin binding motif in mammalian GlyR beta subunits .

  • Co-immunoprecipitation: Researchers can use this method to pull down protein complexes from C. elegans lysates, identifying binding partners of ggr-1.

  • Domain swapping experiments: Similar to studies where an 18-residue segment from mammalian GlyR beta was inserted into GABA₁ receptor subunits, conferring gephyrin binding, researchers can perform domain swapping between ggr-1 and other receptor subunits to identify interaction motifs .

  • Quantitative photoactivated localization microscopy (PALM): This advanced imaging technique can reveal receptor clustering density and dynamics, as demonstrated with mammalian GlyRs (showing alpha-1 containing receptors cluster at densities of ~1100 complexes μm⁻² while alpha-3 containing receptors show ~1500 complexes μm⁻²) .

  • Transfected mammalian cell models: Expressing ggr-1 in mammalian cells alongside potential binding partners can reveal functional interactions, similar to studies where GlyR alpha and beta subunits were co-expressed to demonstrate functional receptor formation .

These methods must be adapted for the C. elegans context, accounting for potential differences in the C. elegans postsynaptic density organization compared to mammalian systems.

What are the best experimental paradigms for analyzing ggr-1 function in neuronal inhibition?

Analyzing ggr-1 function in neuronal inhibition requires integration of molecular, cellular, and behavioral approaches:

  • Electrophysiological characterization:

    • Whole-cell patch-clamp recordings in C. elegans neurons expressing ggr-1

    • Two-electrode voltage clamp in Xenopus oocytes expressing recombinant ggr-1

    • Assessment of channel properties: conductance, ion selectivity, desensitization kinetics

    Mammalian GlyR studies demonstrate the importance of such approaches, revealing that beta subunits significantly alter receptor pharmacology when co-expressed with alpha subunits .

  • Fluorescence-based assays:

    • Anion-sensitive YFP to measure glycine-gated chloride flux

    • NaI-based assays similar to those used for human GlyR α4 X390 studies

    • Fluorescence resonance energy transfer (FRET) to examine subunit proximity

  • Genetic manipulation in C. elegans:

    • CRISPR/Cas9-mediated mutations of ggr-1

    • Tissue-specific knockdown/knockout

    • Rescue experiments with wild-type or mutated ggr-1

  • Behavioral assays in C. elegans:

    • Locomotion analysis

    • Response to glycinergic compounds

    • Stress-induced behaviors

  • Comparative analysis with mammalian systems:

    • Test for functional complementation by expressing ggr-1 in mammalian cells lacking GlyR beta subunits

    • Measure changes in glycine EC₅₀ values and antagonist sensitivity

When designing these experiments, researchers should consider the following data table depicting typical differences between homomeric and heteromeric glycine receptors observed in mammalian systems:

ParameterHomomeric GlyRs (α only)Heteromeric GlyRs (α+β)Potential ggr-1 effect
Glycine EC₅₀Reference value4-fold reductionRequires determination
Picrotoxin sensitivityHigh17-fold lowerRequires determination
Clustering at synapsesPoorEfficientLikely critical
Single-channel conductanceCharacteristicAlteredRequires determination

What approaches can researchers use to investigate post-translational modifications of ggr-1?

Post-translational modifications (PTMs) significantly impact receptor function, trafficking, and clustering. For investigating PTMs of ggr-1, researchers should employ these methodological approaches:

  • Mass spectrometry-based proteomics:

    • Tandem mass spectrometry (MS/MS) to identify specific PTM sites

    • Quantitative MS to determine PTM stoichiometry

    • Phosphoproteomic enrichment for detecting phosphorylation sites

  • Site-directed mutagenesis combined with functional assays:

    • Mutation of potential PTM sites (Ser/Thr/Tyr for phosphorylation)

    • Expression in heterologous systems followed by functional characterization

    • Correlation of mutations with receptor trafficking, clustering, and function

  • Antibody-based detection:

    • Development of PTM-specific antibodies (e.g., phospho-specific)

    • Western blotting, immunoprecipitation, and immunocytochemistry

    • Monitoring changes in PTMs in response to cellular signaling

  • Real-time monitoring of PTMs:

    • FRET-based biosensors to detect conformational changes upon modification

    • Live-cell imaging to track receptor dynamics following PTM-inducing stimuli

  • Pharmacological manipulation:

    • Use of kinase/phosphatase inhibitors to modulate phosphorylation status

    • Treatment with deubiquitinating enzymes to assess ubiquitination

Studies of mammalian GlyRs have revealed that post-translational modifications of receptor-gephyrin interactions induce plastic changes in receptor numbers at synapses . Similar mechanisms might regulate ggr-1 clustering in C. elegans, making this an important area for investigation.

How can researchers effectively design experiments to investigate subunit stoichiometry and assembly of ggr-1-containing receptors?

Determining the subunit stoichiometry and assembly of ggr-1-containing receptors requires specialized biochemical and biophysical approaches:

  • Cross-linking coupled with mass spectrometry:

    • Chemical cross-linking of adjacent subunits

    • Tryptic digestion and MS analysis

    • Identification of subunit interfaces and proximity

  • Single-molecule imaging techniques:

    • Stepwise photobleaching to count subunits

    • Quantitative PALM to determine receptor density and stoichiometry (as demonstrated for mammalian GlyRs showing α₃:β₂ stoichiometry)

    • Single-particle tracking to monitor receptor dynamics

  • Förster Resonance Energy Transfer (FRET):

    • Tagging different subunits with donor/acceptor fluorophores

    • Measuring FRET efficiency to determine subunit proximity

    • FRET spectrometry to assess relative abundance of different subunit combinations

  • Biochemical approaches:

    • Blue native PAGE to preserve native protein complexes

    • Sucrose density gradient centrifugation to separate different receptor assemblies

    • Co-immunoprecipitation with subunit-specific antibodies

  • Functional electrophysiology:

    • Concatemeric constructs with defined subunit composition

    • Single-channel recording to identify conductance states

    • Pharmacological profiling with subunit-selective compounds

The design of these experiments should consider that pentameric ligand-gated ion channels like GlyRs typically assemble with specific stoichiometries. For mammalian GlyRs, heteromeric receptors typically form with a 3α:2β ratio . Researchers investigating ggr-1 should determine whether similar assembly principles apply to C. elegans GlyRs.

What techniques are recommended for resolving contradictory data in ggr-1 expression studies?

When researchers encounter contradictory results in ggr-1 expression studies, a systematic troubleshooting approach should be employed:

  • Standardization of expression systems:

    • Compare expression in multiple cell types (HEK293, CHO, neurons)

    • Standardize transfection methods and efficiency

    • Control for expression levels using quantitative western blotting

  • Validation with multiple detection methods:

    • Combine antibody-based detection with genetic tagging approaches

    • Use orthogonal techniques (western blot, qPCR, immunocytochemistry)

    • Employ CRISPR/Cas9 knockout controls to confirm antibody specificity

  • Comprehensive functional characterization:

    • Compare results from multiple functional assays

    • For electrophysiology, standardize recording conditions and analysis parameters

    • Use both population-based and single-cell approaches

  • Reproducibility assessment:

    • Blind analysis of data to prevent confirmation bias

    • Statistical power analysis to ensure adequate sample sizes

    • Biological and technical replicates across different laboratories

  • Resolution through collaborative approaches:

    • Round-robin testing of reagents and protocols

    • Development of standard operating procedures

    • Community-wide validation of antibodies and expression systems

For example, in mammalian GlyR studies, apparent contradictions regarding function were resolved by recognizing that beta subunits alone do not form functional channels but fundamentally alter the properties of alpha-containing receptors when co-expressed . Similar nuanced interpretations may be needed for ggr-1 studies.

How should researchers design studies to compare ggr-1 function across evolutionary lineages?

Cross-species comparative studies of ggr-1 function require careful experimental design:

  • Sequence analysis and structural modeling:

    • Multiple sequence alignment of ggr-1 with homologs from different species

    • Structural prediction and comparison

    • Identification of conserved functional domains

  • Heterologous expression systems:

    • Express ggr-1 and homologs in the same cell type

    • Control for expression level differences

    • Compare functional properties using standardized assays

  • Chimeric protein approaches:

    • Domain swapping between ggr-1 and homologs

    • Identification of domains responsible for functional differences

    • Progressive mutation of divergent residues

  • In vivo cross-species rescue experiments:

    • Express ggr-1 in mammals lacking specific GlyR subunits

    • Express mammalian GlyR subunits in C. elegans ggr-1 mutants

    • Assess functional complementation

  • Comparative electrophysiology:

    • Standardized recording conditions across species

    • Comparison of key parameters: EC₅₀, desensitization, conductance

    • Pharmacological profiling with consistent drug panels

Researchers should consider that evolutionary studies of GlyR subunits have revealed interesting patterns, such as the finding that GlyR α4 subunit genes are intact in most vertebrates except humans, indicating evolutionary pressures that may also apply to beta-type subunits .

What are the optimal techniques for studying ggr-1 trafficking and synaptic localization?

Investigating ggr-1 trafficking and synaptic localization requires advanced imaging and biochemical approaches:

  • Live-cell imaging techniques:

    • Super-resolution microscopy (STED, PALM) to visualize receptor clusters

    • Single-particle tracking to monitor receptor movement

    • Quantum dot labeling for long-term tracking of individual receptors

  • Pulse-chase experiments:

    • SNAP/CLIP-tag labeling for temporal control

    • Photoconvertible fluorescent proteins to track receptor cohorts

    • Surface biotinylation to distinguish membrane vs. intracellular pools

  • Subcellular fractionation:

    • Synaptosome preparation from C. elegans

    • Density gradient separation of cellular compartments

    • Western blotting to quantify ggr-1 in different fractions

  • Proximity labeling approaches:

    • APEX2 or BioID fusion to ggr-1 to identify nearby proteins

    • Identification of trafficking and scaffolding partners

    • Temporal control of labeling to capture dynamic interactions

  • Quantitative analysis of receptor dynamics:

    • Mean square displacement analysis

    • Diffusion coefficient calculation

    • Dwell time measurement at synaptic sites

Studies of mammalian GlyRs have shown that beta subunits are essential for receptor clustering through gephyrin binding . For ggr-1, researchers should investigate whether similar mechanisms operate in C. elegans, potentially through interaction with the C. elegans gephyrin homolog.

The following table summarizes differences in receptor dynamics observed in mammalian systems that may guide ggr-1 research:

ParameterGlyR α1-containingGlyR α3-containingPotential ggr-1 property
Receptor mobilityHigherLowerRequires determination
Cluster density~1100 complexes μm⁻²~1500 complexes μm⁻²Requires determination
Response to IL-1βReduced synaptic numbersNo changeRequires determination

How can researchers effectively analyze the impact of ggr-1 mutations on receptor function?

To systematically analyze ggr-1 mutations, researchers should employ a multi-level approach:

  • Structure-guided mutagenesis:

    • Target conserved residues identified through sequence alignment

    • Focus on domains known to be critical in mammalian GlyRs

    • Create a library of point mutations, deletions, and chimeras

  • Expression and trafficking analysis:

    • Quantify surface expression using biotinylation or flow cytometry

    • Assess folding efficiency and ER export

    • Monitor glycosylation status as a marker of maturation

  • Functional characterization:

    • Electrophysiological recording of mutant receptors

    • Fluorescence-based anion flux assays

    • Dose-response curves for agonists and antagonists

  • Protein-protein interaction assays:

    • Yeast two-hybrid or split-luciferase assays to quantify interactions

    • Co-immunoprecipitation to assess binding to scaffolding proteins

    • Surface plasmon resonance to measure binding affinities

  • In vivo phenotypic analysis:

    • CRISPR/Cas9-mediated introduction of mutations in C. elegans

    • Behavioral testing of mutant animals

    • Electrophysiological recording from C. elegans neurons

Studies of mammalian GlyRs have demonstrated that mutations in beta subunits can cause severe phenotypes, such as the spastic (spa) phenotype in mice caused by a mutation in the murine GlyR beta subunit gene (Glrb) . Similar approaches could reveal the phenotypic consequences of ggr-1 mutations in C. elegans.

How does ggr-1 research contribute to understanding evolutionary conservation of inhibitory neurotransmission?

ggr-1 research provides valuable insights into the evolution of inhibitory neurotransmission across species:

  • Phylogenetic analysis:

    • Comparison of ggr-1 with glycine receptor subunits across diverse species

    • Identification of conserved functional domains

    • Mapping evolutionary changes to functional differences

  • Conserved structural elements:

    • Analysis of transmembrane domain conservation

    • Comparison of ligand-binding regions

    • Identification of invariant residues suggesting functional importance

  • Divergent mechanisms:

    • Species-specific differences in receptor clustering

    • Evolution of regulatory mechanisms

    • Adaptation to different neuronal architectures

  • Functional conservation testing:

    • Cross-species expression to test functional complementation

    • Comparison of pharmacological properties

    • Evaluation of subunit assembly principles

  • Translational implications:

    • Insights from ggr-1 for understanding human glycinergic neurotransmission

    • Potential for C. elegans as a model system for glycine receptor disorders

    • Evolutionary perspectives on inhibitory circuit organization

Researchers investigating ggr-1 should note that studies of mammalian GlyR subunits have revealed interesting evolutionary patterns, such as the differential conservation of the α4 subunit across vertebrates . Similar evolutionary analyses of beta-type subunits could provide context for understanding ggr-1's role in C. elegans.

What information systems approaches can enhance ggr-1 research information management?

Effective management of ggr-1 research data requires sophisticated information systems approaches:

  • Integrated research databases:

    • Combined storage of sequence, structural, and functional data

    • Cross-linking with model organism databases

    • Integration with protein interaction networks

  • Knowledge representation frameworks:

    • Ontology-based annotation of experimental results

    • Semantic web technologies for data integration

    • Text mining of literature for automated knowledge extraction

  • Collaborative research platforms:

    • Electronic laboratory notebooks for standardized protocols

    • Version-controlled data repositories

    • Collaborative annotation and analysis tools

  • Data visualization techniques:

    • Interactive protein structure viewers

    • Dynamic visualization of electrophysiological data

    • Network visualization of protein-protein interactions

  • Machine learning applications:

    • Prediction of functional effects of mutations

    • Pattern recognition in electrophysiological data

    • Automated literature summarization

Effective information management is particularly important in glycine receptor research due to the terminological confusions and overlapping access to information resources that blur boundaries between different types of information systems . These challenges apply equally to ggr-1 research, particularly when integrating data across different model organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.