Recombinant Glycosyltransferase alg8 (alg8)

Shipped with Ice Packs
In Stock

Description

Catalytic Mechanism and Critical Residues

Alg8’s glycosyltransferase activity relies on conserved residues in its cytosolic domain. Site-directed mutagenesis identified essential residues:

Residue(s)Motif/RoleFunctional ImpactSource
D188/D190DXD motifEssential for polymerization
D295/D296Acid-base catalystsRequired for enzymatic activity
K297Electrophilic residueCritical for polymerization
C244Cysteine residueNon-critical (no impact)

Mutations in D188/D190 or D295/D296 abolished alginate production, while K297 substitution reduced activity by >90% . These residues likely coordinate GDP-mannuronic acid or facilitate chain elongation.

Role in Alginate Biosynthesis

Alg8 is indispensable for alginate polymerization. Key findings include:

  • Essential for polymerization: Deletion of alg8 in P. aeruginosa abolishes alginate production, restored only by recombinant alg8 .

  • Bottleneck in production: Overexpression of alg8 increases alginate yield 15–20-fold compared to wild-type strains, indicating Alg8 limits biosynthesis .

  • Impact on polymer composition: Recombinant Alg8 overproduction reduces guluronic acid (G) content (from 38% to 19%) and increases acetylation (from 4.7% to 9.3%) .

Table 2: Alg8 Overexpression Effects on Alginate Production

StrainAlg8 CopiesAlginate Yield (g/g dry weight)G Content (%)Acetylation (%)Source
P. aeruginosa PDO30010.1–0.2384.7
P. aeruginosa Δalg8(pBBR1MCS-5:alg8)15–202.5199.3

Regulatory Interactions and Activation

Alg8’s activity is modulated by c-di-GMP and Alg44, a PilZ domain protein:

  • c-di-GMP binding: Alg44 binds c-di-GMP, triggering a conformational change that activates Alg8. Mutations in Alg44’s PilZ domain (e.g., H323E) disrupt this interaction, reducing alginate production to 60% of wild-type levels .

  • Transmembrane signaling: Alg8 and Alg44 form a complex in the cytoplasmic membrane, with Alg44 acting as a regulatory partner .

Recombinant Expression and Biotechnological Applications

Recombinant Alg8 has been expressed in heterologous systems for alginate overproduction:

  • Vectors: alg8 cloned into pBBR1MCS-5 under lac promoter control enables high-copy expression .

  • Tagged variants: C-terminal hexahistidine tags or fusion proteins (e.g., PhoA, GFP) do not impair activity, enabling purification and localization studies .

  • Industrial relevance: Engineered strains with alg8 overexpression could enhance alginate yield for use in food additives, pharmaceuticals, or biofilms .

Clinical and Research Implications

Alg8 is a target for disrupting biofilm formation in P. aeruginosa, a pathogen in cystic fibrosis. Inhibiting Alg8 could prevent biofilm-associated infections, though no inhibitors are currently available. Structural studies of Alg8’s catalytic domain may guide rational drug design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include this information in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
alg8; Glycosyltransferase alg8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Azotobacter vinelandii
Target Names
Target Protein Sequence
MDRLKHALGEATGWLLFLSFLMLVAVALPPQVFDPESKHFIMLIGLIGVWRYSMGIIHFL RGMLFLYVVYPYYRRKVEKLGKDADPSHVFLMVTSFRIDALTTGKVYGSVIKEAINCGYP TTVVCSIVEMSDELLIKSLWEKLDPPDRVKLDFVRIAGTGKRDGLANGFRAISRHMPDED AVVAVIDGDTVLNEGVVRKTVPLFQDLPQHGWPDHQRILRSAGRLRHERVAQVRFAQRHI NMCSMALSHRVLTLTGRMSVFRAVVTDPEFIVDVENDNLDHWRLGRFKFLTGDDKSSWFS LMRLGYDTFYVPDASIHTVEHPPEKRFVKASRKLMFRWYGNNLRQNSRALKLGVQRLGWF TSVVLFDQRVSMWTSLLGLTVAIIGSIKYSIAIFIAYLLWVCSTRLVLTLLLSLSGHPIG PAYPLILYYNQIVGAVVKIHVFFRLDQQSWTRQDTKLNRELASFQSWFNNWSSKAMTFSA TSIFIAVLMLSV
Uniprot No.

Target Background

Function
Alg8 is likely a processive enzyme that polymerizes GDP-mannuronic acid.
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ALG8 in alginate biosynthesis?

ALG8 serves as the putative catalytic subunit of alginate polymerase, responsible for linking mannuronic acid residues from GDP-mannuronic acid to form the alginate polymer. Experimental evidence firmly establishes that ALG8 is essential for alginate production in Pseudomonas aeruginosa. Deletion of the alg8 gene results in complete loss of alginate production, with no detectable uronic acid monomers or oligomers in culture supernatants. This distinguishes alg8 deletion mutants from mutants deficient in algK, algG, or algX, which show uronic acid oligomers in supernatants due to degradation by alginate lyase .

Notably, when alg8 deletion mutants are complemented with the alg8 gene, not only is alginate production restored, but it is significantly enhanced compared to the wild-type strain. This indicates that ALG8 constitutes the bottleneck in alginate biosynthesis, with its overexpression leading to a 15-20 fold increase in alginate production .

What is known about the membrane topology and subcellular localization of ALG8?

ALG8 is an integral membrane protein embedded in the cytoplasmic membrane of P. aeruginosa. Topological analyses using prediction tools such as SMART and TMHMM2 indicate that ALG8 possesses:

  • A signal sequence at the N-terminus (amino acids 1-32)

  • Four transmembrane helices

  • A large cytosolic loop at the N-terminus containing the putative catalytic domain

  • A C-terminus located in the periplasm

The proposed topology has been experimentally validated through the construction of C-terminal fusion proteins with reporter enzymes (LacZ, PhoA, and GFP). The functionality of these fusion proteins was confirmed by their ability to restore alginate production in alg8 deletion mutants. Analysis of alkaline phosphatase activity in Alg8-PhoA fusion protein, which is only active in the periplasm, provided evidence that the C-terminus of ALG8 is located in the periplasmic space .

Subcellular fractionation experiments further supported this topology, with the highest specific PhoA activity being detected in the cytoplasmic membrane fraction. The cytosolic location of the catalytic domain is consistent with the availability of its substrate, GDP-mannuronic acid, in the cytosol .

How does the structure of ALG8 relate to its enzymatic function?

A structural model of ALG8 has been developed based on the known structure of glycosyltransferase SpsA from Bacillus subtilis. This model reveals important structure-function relationships:

  • The N-terminal domain shares homology with class II β-glycosyltransferases

  • The model indicates that residues Asp 161, Asp 250, and Cys 215 are located in or adjacent to the core structure

  • These residues are likely involved in substrate binding, as homologous amino acids are responsible for nucleotide-sugar binding in SpsA

The proposed structural model is consistent with ALG8's function as a glycosyltransferase, with the catalytic domain positioned to access cytosolic GDP-mannuronic acid while the transmembrane domains may facilitate translocation of the growing polymer across the membrane .

What expression systems are recommended for producing recombinant ALG8 for biochemical studies?

As a membrane protein, ALG8 presents significant challenges for recombinant expression and purification. Based on successful experimental approaches, the following strategies are recommended:

Expression system selection:

  • The broad-host-range vector pBBR1MCS-5 has been successfully used to express ALG8 in P. aeruginosa alg8 deletion mutants under the control of the lac promoter

  • For heterologous expression, consider using E. coli strains optimized for membrane protein expression (C41, C43)

  • Lower temperatures (16-25°C) and reduced inducer concentrations typically improve membrane protein folding

Protein tagging strategies:

  • C-terminal tagging appears to be well-tolerated, as functional studies with hexahistidine, PhoA, GFP, and LacZ fusions have been successful

  • The C-terminal tag should be chosen based on the intended downstream applications (purification, localization, activity assays)

Purification considerations:

  • Detergent selection is critical for maintaining protein stability and activity

  • Consider reconstitution into liposomes or nanodiscs to restore a lipid bilayer environment

  • The envelope fraction showed the highest specific alginate polymerase activity, suggesting that both cytoplasmic and outer membrane components may be required for optimal function

How can the enzymatic activity of recombinant ALG8 be measured in vitro?

An enzymatic in vitro alginate polymerase assay has been established using 14C-labeled GDP-mannuronic acid as a substrate. This assay can be adapted to measure the activity of recombinant ALG8 using the following methodology:

  • Prepare subcellular fractions containing ALG8 or purified recombinant protein

  • Incubate with 14C-labeled GDP-mannuronic acid under appropriate buffer conditions

  • Measure incorporation of 14C-labeled mannuronic acid into polymeric alginate

  • Quantify activity based on radioactivity incorporation

When using this assay, it's important to note that the highest specific alginate polymerase activity was detected in the envelope fraction, with no activity detected in isolated cytoplasmic or outer membrane fractions. This suggests that components from both membrane compartments may constitute the functional alginate polymerase complex .

Alternative methods for measuring ALG8 activity could include:

  • HPLC-based assays monitoring GDP-mannuronic acid consumption

  • Mass spectrometry to detect polymer formation

  • Colorimetric assays for alginate detection

What effect does ALG8 overexpression have on alginate composition and properties?

ALG8 overexpression not only increases the quantity of alginate produced but also significantly alters its composition and physical properties. 1H-NMR analysis of alginates isolated from wild-type P. aeruginosa PDO300 and complemented alg8 deletion mutants revealed the following changes:

ParameterWild-type P. aeruginosa PDO300Complemented mutant P. aeruginosa PDO300Δalg8Effect
Degree of acetylation4.7%9.3%Increased
Guluronic acid content38%19%Decreased
Frequency of mannuronic acid doublet (F MM)24%62%Increased

These compositional changes were associated with noticeable differences in alginate solubility and viscosity. The reduced guluronic acid content and increased acetylation would be expected to affect the mechanical properties of the polymer, potentially impacting biofilm structure and stability .

The mechanism by which ALG8 overexpression affects polymer composition is not yet fully understood, but it may involve:

  • Altered polymerization kinetics affecting subsequent modification steps

  • Changes in the interaction between ALG8 and other proteins in the biosynthesis complex

  • Different substrate availability for the modifying enzymes

What are the key residues involved in ALG8 catalytic activity and how can they be identified?

Based on structural modeling and homology with other glycosyltransferases, several key residues in ALG8 have been proposed to be important for catalytic activity:

  • Asp 161

  • Asp 250

  • Cys 215

These residues are located in or adjacent to the core structure of the enzyme and might be involved in substrate binding, as homologous amino acids are responsible for nucleotide-sugar binding in the related enzyme SpsA .

A comprehensive strategy to identify and characterize catalytic residues would include:

  • Site-directed mutagenesis:

    • Create point mutations of proposed catalytic residues (e.g., D161A, D250A, C215A)

    • Target additional conserved residues identified through sequence alignment

  • Functional complementation:

    • Transform P. aeruginosa alg8 deletion mutants with plasmids expressing mutated alg8 variants

    • Assess alginate production to determine the impact of each mutation

  • In vitro activity assays:

    • Compare enzymatic activities of wild-type and mutant proteins

    • Determine kinetic parameters to distinguish effects on substrate binding versus catalysis

The researchers note that identifying these catalytic residues could "shed light into the alginate polymerization reaction and might enable the design of inhibitors that are able to block polymerization and therefore impair biofilm formation in cystic fibrosis patients" .

How does ALG8 interact with other proteins in the alginate biosynthesis complex?

ALG8 functions as part of a multiprotein complex involved in alginate biosynthesis. While all interactions haven't been fully characterized, evidence suggests coordination between several proteins:

  • Alg8: Putative glycosyltransferase, catalytic subunit of alginate polymerase

  • Alg44: Transmembrane protein, proposed polymerase subunit

  • AlgK and AlgX: Periplasmic proteins forming a scaffold that protects the nascent polymer

  • AlgG: Mannuronan C-5 epimerase that also contributes to the protective scaffold

  • AlgL: Alginate lyase potentially involved in quality control

Evidence for these interactions comes from several observations:

  • The highest specific alginate polymerase activity was detected in the envelope fraction, with no activity detected in isolated membrane fractions, suggesting that components from multiple cellular compartments are required

  • Deletion mutants of algK, algG, and algX show secretion of uronic acid oligomers due to degradation by alginate lyase, suggesting these proteins form a protective scaffold around the nascent polymer

  • The proteins AlgK, AlgX, and AlgG are "supposed to be part of a scaffold surrounding the nascent alginate chain"

Experimental approaches to further characterize these interactions could include bacterial two-hybrid systems, co-immunoprecipitation, cross-linking studies, and proximity labeling techniques.

What strategies can be employed to develop and screen inhibitors of ALG8 activity?

Developing inhibitors of ALG8 has potential therapeutic applications, particularly for treating P. aeruginosa infections in cystic fibrosis patients. A comprehensive approach would include:

  • Structure-based inhibitor design:

    • Use the structural model of ALG8 based on SpsA

    • Focus on the proposed active site residues (Asp 161, Asp 250, Cys 215)

    • Design compounds that mimic the nucleotide-sugar substrate

  • High-throughput screening methodology:

    • Utilize the established in vitro alginate polymerase assay with 14C-labeled GDP-mannuronic acid

    • Screen compound libraries for inhibition of polymerase activity

    • Validate hits through secondary assays and dose-response curves

  • Cell-based screening approaches:

    • Assess compound effects on alginate production in P. aeruginosa

    • Quantify alginate production and biofilm formation

    • Evaluate cytotoxicity against mammalian cells

  • Validation and optimization:

    • Determine mechanism of inhibition through enzyme kinetics

    • Perform structure-activity relationship analysis

    • Assess pharmacological properties and potential for resistance development

As noted in the research, "The identification of catalytic residues might shed light into the alginate polymerization reaction and might enable the design of inhibitors that are able to block polymerization and therefore impair biofilm formation in cystic fibrosis patients. Furthermore, inhibitors of alginate polymerization could be identified using the in vitro alginate synthesis assay as screening tool" .

What methodologies are available for studying the membrane topology of ALG8?

Several complementary techniques can be employed to investigate the membrane topology of ALG8:

  • Fusion protein analysis:

    • C-terminal fusions with reporter proteins like PhoA (active in periplasm) and LacZ (active in cytoplasm)

    • Analysis of reporter activity can indicate the cellular localization of protein domains

    • This approach was successfully used to determine that ALG8's C-terminus is located in the periplasm

  • Subcellular fractionation:

    • Separation of cellular components (cytoplasm, cytoplasmic membrane, periplasm, outer membrane)

    • Western blot analysis to detect ALG8 in different fractions

    • Measurement of specific activity in different fractions (as done with ALG8-PhoA fusions)

  • Cysteine scanning mutagenesis:

    • Introduction of cysteine residues at various positions

    • Accessibility to membrane-impermeable sulfhydryl reagents indicates periplasmic exposure

  • Computational prediction:

    • Use of topology prediction tools such as SMART and TMHMM2

    • These tools predicted a signal sequence and four transmembrane helices in ALG8

  • GFP fusion analysis:

    • C-terminal GFP fusions for localization studies

    • Fluorescence microscopy to visualize subcellular distribution

The combination of computational prediction and experimental validation through fusion proteins has already provided valuable insights into ALG8 topology, confirming its membrane localization with a periplasmic C-terminus .

What are the challenges in purifying active recombinant ALG8 and how can they be addressed?

Purifying active recombinant ALG8 presents several challenges due to its membrane-associated nature:

  • Expression challenges:

    • Membrane protein overexpression can be toxic to host cells

    • Protein misfolding and aggregation are common

    • Limited membrane space in expression hosts

  • Extraction and solubilization issues:

    • Finding suitable detergents that maintain protein structure and activity

    • Balancing efficient extraction and native fold preservation

    • Potential loss of essential lipid interactions

  • Activity maintenance:

    • Loss of the native membrane environment can impact function

    • Requirement for specific lipids or protein partners

    • Stability issues in detergent solutions

Strategies to address these challenges include:

  • Optimized expression conditions:

    • Controlled, slow expression (lower temperature, reduced inducer concentration)

    • C-terminal fusion tags that don't interfere with membrane insertion

    • Use of specialized strains designed for membrane protein expression

  • Improved solubilization approaches:

    • Screening multiple detergents and detergent mixtures

    • Novel solubilization agents (SMALPs, nanodiscs)

    • Co-solubilization with native lipids

  • Alternative purification strategies:

    • Purification of membrane fragments containing ALG8

    • In-situ activity assays without complete purification

    • Early reconstitution into liposomes during purification

The observation that the highest specific alginate polymerase activity was detected in the envelope fraction suggests that ALG8 may function optimally in its native membrane environment and in complex with other proteins . This presents both a challenge and an opportunity for studying its biochemical properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.