Recombinant Glycyrrhiza echinata Licodione synthase (CYP93B1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Glycyrrhiza echinata Licodione synthase, also known as CYP93B1, is a cytochrome P450 monooxygenase enzyme that plays a crucial role in the biosynthesis of isoflavonoids and retrochalcones in Glycyrrhiza echinata (licorice) cells . Isoflavonoids possess various medicinal properties, including antioxidant, antiviral, and anti-inflammatory activities .

Discovery and Isolation

CYP93B1 was identified and isolated from a cDNA library of elicited G. echinata cells . Researchers obtained eight P450 fragments (Ge-1 to Ge-8) from the cDNA library using a PCR-based method . Full-length P450 cDNAs, CYP93B1 and CYP81E1, corresponding to the fragments Ge-5 and Ge-3, were then cloned .

Function and Mechanism

CYP93B1 functions as a (2S)-flavanone 2-hydroxylase (F2H) and licodione synthase . It catalyzes the hydroxylation of (2S)-flavanones, such as liquiritigenin and naringenin, at the C-2 position, leading to the formation of 2-hydroxyisoflavanones . These products can then be converted to isoflavones like daidzein and genistein through acid treatment . Licodione synthase activity increases in cells treated with yeast extract .

The enzyme can employ both 5-deoxyflavanone (liquiritigenin) and 5-hydroxyflavanone (naringenin) as substrates . In G. echinata microsomes, CYP93B1 competes with isoflavone synthase (IFS) for the same substrates .

Enzyme Assays and Products

G. inflata expresses an LMT gene, GiLMT1, that impacts the biosynthesis of Licochalcone A (LCA) . GiLMT1 can add a methyl group to licodione, an intermediate in LCA biosynthesis .

Table 1: Enzyme reaction products formed by recombinant GiLMT1 protein with licodione and its isomer as substrates

SubstrateProduct
Licodione2′-O-methyllicodione (P1)
Licodione IsomerP2

Regulation

Histone deacetylases (HDACs) like GiSRT2 negatively regulate flavonoid biosynthesis . When GiSRT2 expression is suppressed, Licochalcone A (LCA) and total flavonoid levels increase .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP93B1; Licodione synthase; (2S-flavanone 2-hydroxylase; CYP GE-5; Cytochrome P450 93B1; Flavone synthase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-523
Protein Length
full length protein
Species
Glycyrrhiza echinata (Licorice)
Target Names
CYP93B1
Target Protein Sequence
MEPQLVAVSVLVSALICYFFFRPYFHRYGKNLPPSPFFRLPIIGHMHMLGPLLHQSFHNL SHRYGPLFSLNFGSVLCVVASTPHFAKQLLQTNELAFNCRIESTAVKKLTYESSLAFAPY GDYWRFIKKLSMNELLGSRSINNFQHLRAQETHQLLRLLSNRARAFEAVNITEELLKLTN NVISIMMVGEAEEARDVVRDVTEIFGEFNVSDFIWLFKKMDLQGFGKRIEDLFQRFDTLV ERIISKREQTRKDRRRNGKKGEQGSGDGIRDFLDILLDCTEDENSEIKIQRVHIKALIMD FFTAGTDTTAISTEWALVELVKKPSVLQKVREEIDNVVGKDRLVEESDCPNLPYLQAILK ETFRLHPPVPMVTRRCVAECTVENYVIPEDSLLFVNVWSIGRNPKFWDNPLEFRPERFLK LEGDSSGVVDVRGSHFQLLPFGSGRRMCPGVSLAMQEVPALLGAIIQCFDFHVVGPKGEI LKGDDIVINVDERPGLTAPRAHNLVCVPVDRTSGGGPLKIIEC
Uniprot No.

Target Background

Function

This enzyme catalyzes the formation of licodione and 2-hydroxynaringenin from (2S)-liquiritigenin and (2S)-naringenin, respectively. It also converts eriodictyol to luteolin.

Database Links

KEGG: ag:BAA22423

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.