Recombinant Gnetum parvifolium ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Gnetum parvifolium ATP synthase subunit b, chloroplastic (atpF) is a protein component of the ATP synthase complex found in the chloroplasts of Gnetum parvifolium, a plant species . ATP synthase, also known as F1F0-ATPase or Complex V, is an enzyme that produces adenosine triphosphate (ATP) from adenosine diphosphate (ADP) using a proton gradient across a membrane . ATP is the primary source of energy in cells, and its synthesis is crucial for cellular function .

Structure and Function

The ATP synthase enzyme consists of two main components: F0 and F1 . The F0 component is embedded in the membrane and acts as a proton channel, while the F1 component is located in the chloroplast stroma and contains the catalytic sites for ATP synthesis . The atpF subunit, or subunit b, is a part of the F0 complex and is essential for the assembly and function of the entire ATP synthase complex . Specifically, the rotation of the central stalk against the surrounding alpha3beta3 subunits leads to ATP hydrolysis in three separate catalytic sites on the beta subunits .

Gnetum parvifolium as a Source

Gnetum parvifolium is a plant species in which the atpF subunit has been identified and studied . The recombinant form of this protein is produced through genetic engineering techniques, allowing for detailed studies of its structure, function, and interactions within the ATP synthase complex .

Recombinant Production and Applications

Recombinant atpF is produced for research purposes, enabling scientists to investigate the properties of this subunit in isolation and within the larger ATP synthase complex . Recombinant proteins are valuable tools for biochemical and biophysical studies, as well as for biotechnological applications .

Data Table

The following table summarizes key information about recombinant Gnetum parvifolium ATP synthase subunit b, chloroplastic (atpF):

PropertyDescription
Protein NameATP synthase subunit b', chloroplastic
Alternative Name(s)ATP synthase F(0) sector subunit b', ATPase subunit II
Gene NameatpG
SpeciesGnetum parvifolium
Expression Region1-156
Sequence InfoFull length protein
StorageStore at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your requirements for preferential development of a particular tag type.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Gnetum parvifolium (Small-leaved jointfir) (Gnetum scandens var. parvifolium)
Target Names
atpF
Target Protein Sequence
MKGIANSLIYLSYWPSAGSFGFNTNILETNIINITVVLGILIYFGKGVLSNLLDNRKSKI YSTIQNSEELCKGARHQLEKARARLQEIEMRVDEIRANGYLQIEQEKEDLVQAASVNLKQ LEDSKNETVSFEQQKVIDQVRQQVSYQALQKALTFMKNCLNTELHLRMINYNIGRLRAKR TGQFL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes ATP synthesis from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembraneous) and the F(0) membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel and contributes to the peripheral stalk, linking F(1) and F(0).
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b in chloroplasts?

ATP synthase subunit b functions as an essential component of the F₁F₀-ATP synthase complex in chloroplasts. It forms part of the peripheral stalk that connects the F₁ and F₀ domains, helping maintain structural integrity during the rotational catalysis mechanism. The subunit facilitates energy coupling between the transmembrane proton gradient and ATP synthesis by contributing to the proper alignment of catalytic interfaces . In chloroplasts specifically, this subunit helps harness the proton gradient generated during photosynthesis to drive ATP production.

How does ATP synthase β-subunit contribute to ATP synthesis mechanics?

The β-subunit contains catalytic sites that bind ADP and phosphate to synthesize ATP. Research has shown that this subunit undergoes significant conformational changes during catalysis, with each β-subunit within the F₁ complex existing in different conformational states (loose, tight, or empty) depending on its position in the catalytic cycle .

The β-subunit functions through:

  • Formation of nucleotide binding pockets at α/β interfaces

  • Execution of conformational changes that power the binding change mechanism

  • Participation in rotational catalysis through interaction with the γ subunit via the DELSEED-loop

Molecular evidence indicates that allosteric cooperativity between the three catalytic sites in F₁ enables the enzyme to harness proton motive force efficiently for ATP synthesis .

What conserved motifs are essential for ATP synthase function?

The DELSEED motif (Asp-Glu-Leu-Ser-Glu-Glu-Asp) within a helix-turn-helix structure in the C-terminal domain of the β subunit is highly conserved across species and plays a critical role in coupling catalysis to rotation . This region forms a loop that makes contact with the γ subunit during rotational catalysis.

While the charged residues in the DELSEED motif were initially thought to be essential, mutation studies replacing these residues with alanine (creating an AALSAAA mutant) demonstrated that the enzyme could still drive rotation of the γ subunit with normal torque . This finding suggests that it is the physical structure and length of the DELSEED-loop, rather than specific electrostatic interactions, that are critical for function.

What experimental systems can be used to study recombinant ATP synthase subunits?

Several experimental systems have proven effective for investigating ATP synthase structure-function relationships:

Experimental SystemApplicationsAdvantages
E. coli expression systemsProduction of recombinant subunitsHigh yield, established protocols
Inverted membrane vesiclesATP synthesis/hydrolysis assaysMaintains native-like environment
Isolated subcomplexes (α₃β₃γ)Rotation and binding studiesSimplified system for mechanistic studies
Hybrid enzymes with subunits from different speciesAnalysis of specific subunit functionsAllows isolation of subunit-specific effects

For recombinant Gnetum parvifolium ATP synthase subunit studies, bacterial expression systems can be adapted from protocols used for other plant ATP synthase components . The method typically involves:

  • Cloning the atpF gene from Gnetum parvifolium

  • Introduction into an expression vector with appropriate promoter and purification tags

  • Expression in E. coli strain optimized for membrane protein production

  • Purification using affinity chromatography (e.g., Ni²⁺-NTA columns for His-tagged proteins)

  • Functional reconstitution with other ATP synthase subunits

How can deletion mutants be used to study critical functional regions?

Deletion mutagenesis is a powerful approach for identifying critical functional regions, as demonstrated by studies on the DELSEED-loop . A methodological workflow includes:

  • Design deletion constructs removing specific amino acid segments

  • Generate mutants using site-directed mutagenesis

  • Express in a suitable host system (e.g., E. coli DK8 strain lacking endogenous ATP synthase)

  • Confirm expression levels using Western blot analysis with specific antibodies

  • Prepare membrane vesicles for functional assays

  • Assess ATP synthesis, ATP hydrolysis, and proton-pumping activities

  • Measure nucleotide binding to catalytic sites

Studies deleting portions of the DELSEED-loop found that removing 10 residues abolished ATP synthesis capability while retaining ATPase activity, while deletion of 14 residues eliminated all enzymatic function . This approach allowed researchers to determine that shortening the loop by approximately 10Å defines the minimum length required for coupling catalysis and rotation.

How do conformational changes in the β-subunit couple to ATP synthesis?

The β-subunit undergoes significant conformational changes during catalysis that are transmitted through the enzyme complex. Research on spinach chloroplast ATP synthase revealed that the cysteine residue at position 63 is positioned at the interface between α and β subunits and is conformationally coupled to the nucleotide binding site located more than 40Å away .

Fluorescence resonance energy transfer (FRET) experiments can be used to measure these conformational changes:

  • Introduce fluorophore attachment sites through strategic cysteine mutations

  • Label purified subunits with donor and acceptor fluorescent probes

  • Measure changes in FRET efficiency during catalysis

  • Correlate FRET changes with enzymatic states

These studies have shown that conformational changes in the β-subunit's amino-terminal domain are critical for coupling nucleotide binding at catalytic sites to transmembrane proton movement .

What is the relationship between extracellular ATP signaling and ATP synthase in plants?

Interestingly, ATP synthase β-subunit has functions beyond its role in energy metabolism. Research in Arabidopsis has identified it as a target for extracellular ATP (eATP) signaling pathways involved in programmed cell death regulation .

In Arabidopsis cell suspension cultures treated with fumonisin B1 (FB1), a mycotoxin that triggers cell death:

  • FB1 treatment causes depletion of extracellular ATP

  • Supplementation with exogenous ATP rescues cells from death

  • ATP synthase β-subunit was identified among 26 proteins regulated by extracellular ATP signaling

  • Knockout of the ATP synthase β-subunit gene conferred resistance to FB1-induced cell death

This suggests a novel role for ATP synthase β-subunit as a pro-cell death protein regulated by extracellular ATP signaling, independent of its function in mitochondrial oxidative phosphorylation .

How can molecular modeling inform ATP synthase research?

Molecular modeling can predict structural consequences of mutations or deletions in ATP synthase subunits. For the DELSEED-loop, modeling was used to estimate changes in loop length resulting from various deletions:

These predictions can be validated experimentally using techniques like FRET, as demonstrated in studies that confirmed the modeling results for the 10-residue deletion mutant .

What techniques are most effective for analyzing ATP synthase activity?

Several complementary techniques provide comprehensive functional analysis:

  • Growth assays: Testing growth of E. coli strains expressing mutant ATP synthases in limiting glucose conditions can quickly assess ATP synthesis capability in vivo .

  • Enzyme activity measurements:

    • ATP hydrolysis activity: Typically measured using a coupled enzyme assay that monitors NADH oxidation

    • ATP synthesis activity: Measured by monitoring ATP production using the luciferin-luciferase assay

    • Temperature dependence analysis: Provides insights into enzyme stability and conformational flexibility

  • Proton pumping assays:

    • NADH-driven H⁺-pumping: Assesses the integrity of the proton channel

    • ATP-driven H⁺-pumping: Tests the coupling between ATP hydrolysis and proton movement

  • Nucleotide binding studies:

    • Fluorescent nucleotide analogs to measure binding affinities

    • Equilibrium binding assays to determine number and affinity of binding sites

The AALSAAA mutant, in which all negative charges of the DELSEED motif were removed, showed normal patterns for MgATP binding to catalytic sites with a clearly present high-affinity site, demonstrating that the negative charges are not essential for nucleotide binding .

How can recombinant proteins be used for structural studies of ATP synthase?

Recombinant expression of individual subunits or subcomplexes enables detailed structural investigations:

  • X-ray crystallography: Requires milligram quantities of highly purified protein

    • Expression of isolated subunits (as done with β-subunit)

    • Crystallization trials with varying conditions

    • Structure determination and refinement

  • Cryo-electron microscopy:

    • Suitable for large complexes like intact ATP synthase

    • Sample preparation with minimal fixing or staining

    • Image processing and 3D reconstruction

  • NMR spectroscopy:

    • Suitable for smaller subunits or domains

    • Requires isotopic labeling (¹⁵N, ¹³C)

    • Provides dynamics information not available from static structures

Researchers studying ATP synthase components have successfully used Ni²⁺-NTA affinity chromatography to purify His-tagged recombinant proteins, with elution using 500 mM imidazole and 100 mM NaCl (pH 7.0) . For long-term storage, proteins can be preserved as precipitates in 70% saturated ammonium sulfate at 4°C.

How can comparative studies between species inform ATP synthase research?

Comparative studies between ATP synthase from different species can reveal evolutionary conservation and specialization. The successful complementation of E. coli ATP synthase with the β subunit from spinach chloroplast demonstrates the functional conservation of these components across widely divergent species .

For Gnetum parvifolium, as a gymnosperm with distinctive evolutionary history, comparative studies might reveal unique adaptations in ATP synthase structure and function. Key approaches include:

  • Sequence alignment of atpF genes across plant lineages

  • Expression of hybrid enzymes containing components from different species

  • Functional characterization of chimeric complexes

  • Evolutionary rate analysis to identify regions under selection pressure

These comparative approaches can identify conserved functional regions and species-specific adaptations in ATP synthase components.

What are the implications of ATP synthase research for understanding plant energy metabolism?

ATP synthase research contributes to understanding plant bioenergetics at multiple levels:

  • Cellular level: Elucidating the molecular mechanisms of energy conversion in chloroplasts and mitochondria

  • Organismal level: Understanding how energy metabolism affects plant growth, development, and stress responses

  • Ecological level: Revealing adaptations in energy metabolism that contribute to plant survival in different environments

The discovery that ATP synthase β-subunit functions in programmed cell death regulation highlights how energy metabolism components can serve dual roles in plant physiology, connecting primary metabolism with stress responses and developmental programs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.