Recombinant Gnetum parvifolium Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Gnetum parvifolium (Small-leaved jointfir) (Gnetum scandens var. parvifolium)
Target Names
ycf4
Target Protein Sequence
MNHQAKRLWIEPIKGSRRKSNFFFASIILGGALGFLLVGFSSYIGRNLVPPLLSHQILFV PQGIVMCFYGIAGLFFSSYLWCTILFNVGGGYNKIMKKKEFYVFFAGVSQGKIVVFFLRV PLKNVQTIKMEVQESLFYSRHVLYMKVKGLPDIPLARTGDHFNLSEMEQKAAELAHFLRV SIEGF
Uniprot No.

Target Background

Function
Plays a crucial role in the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How is the Recombinant Ycf4 protein from G. parvifolium typically produced for research purposes?

    Production of recombinant Ycf4 from G. parvifolium typically follows these methodological steps:

    1. Gene isolation using PCR amplification from chloroplast DNA with primers designed based on the known ycf4 sequence (Expression Region: 1-185)

    2. Cloning into an appropriate expression vector (often bacterial)

    3. Expression in a suitable host system (commonly E. coli)

    4. Purification using affinity chromatography (the tag type is determined during the production process)

    5. Storage in optimized buffer conditions (typically Tris-based buffer with 50% glycerol)

    The final product is stored at -20°C or -80°C for extended storage, with working aliquots recommended to be kept at 4°C for up to one week to avoid repeated freeze-thaw cycles that could compromise protein integrity .

  • What is the evolutionary significance of Ycf4 in G. parvifolium compared to other plant species?

    G. parvifolium belongs to Gnetales, a small, unique group with a controversial phylogenetic position among gymnosperms. The evolutionary significance of Ycf4 in G. parvifolium must be understood in this context:

    • Compared to other seed plants, Gnetum species including G. parvifolium have significantly lower photosynthetic capacity, with mean Pn values of 1.3 ± 0.33 μmol m⁻² s⁻¹ CO₂ , which may relate to the function of their photosynthetic apparatus including PSI assembly.

    • Studies of chloroplast genomes reveal that Gnetum species lack 17 coding genes compared to other seed plants, contributing to their lower photosynthetic rates .

    • Unlike in the green alga Chlamydomonas reinhardtii where Ycf4 is essential for photoautotrophic growth , in vascular plants like G. parvifolium, there appears to be some functional redundancy or alternative mechanisms for PSI assembly.

    This evolutionary pattern suggests adaptive changes in the photosynthetic machinery of Gnetales during their divergence from other gymnosperm lineages .

Intermediate Research Questions

  • What techniques are used to study the protein-protein interactions of Ycf4 in the PSI assembly process?

    Several complementary techniques are employed to study Ycf4 protein interactions:

    1. Tandem Affinity Purification (TAP): As demonstrated in studies with Chlamydomonas, TAP-tagged Ycf4 can be used to isolate stable Ycf4-containing complexes. This involves:

      • Fusion of a TAP tag to the C-terminus of Ycf4

      • Two-step affinity column chromatography

      • Analysis of co-purified proteins by mass spectrometry

    2. Immunoprecipitation followed by LC-MS/MS: This technique identifies proteins that interact with Ycf4 in vivo.

    3. In silico molecular docking: Computational studies reveal potential binding sites and interaction strength. For example, the carboxyl terminus of YCF4 demonstrates stronger interactions with photosynthetic proteins than the amino terminus, forming more hydrogen bonds with various PSI components .

    4. Yeast two-hybrid assays: For validating specific binary protein interactions.

    5. Blue Native-PAGE: For analyzing intact protein complexes containing Ycf4.

    These approaches have revealed that Ycf4 interacts with multiple PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) and other proteins involved in PSI assembly .

  • How do mutations in the ycf4 gene affect photosynthetic efficiency in different plant models?

    The effects of ycf4 mutations vary significantly between plant models:

    • In Chlamydomonas reinhardtii: Disruption of ycf4 results in complete inability to grow photoautotrophically. Mutants lack PSI activity and the PSI complex does not accumulate stably in thylakoid membranes, despite normal transcription of PSI genes .

    • In tobacco (Nicotiana tabacum): Knockout plants show reduced photosynthetic performance but can still grow photoautotrophically, suggesting that Ycf4 enhances but is not essential for PSI assembly in higher plants .

    • In cyanobacteria: Mutants deficient in Ycf4 can still assemble the PSI complex, though at reduced levels. These mutants show significant differences in pigment content, especially in the phycocyanin to chlorophyll ratio .

    • In Gnetum species: While specific knockout studies in G. parvifolium have not been reported, the naturally lower photosynthetic rates in Gnetum compared to other seed plants may partially relate to differences in PSI assembly facilitated by Ycf4 .

    These differential effects suggest evolutionary adaptations in the PSI assembly process across lineages, with varying degrees of dependence on Ycf4 .

  • What are the recommended protocols for assessing Ycf4 functionality in chloroplast preparations?

    To assess Ycf4 functionality in chloroplast preparations, researchers should follow these methodological approaches:

    1. Isolation of intact chloroplasts:

      • Use Percoll gradient centrifugation to obtain purified chloroplasts

      • Verify integrity by microscopy and chlorophyll fluorescence

    2. Thylakoid membrane isolation:

      • Extract using buffer containing 330 mM sorbitol, 50 mM HEPES-KOH (pH 7.8), 2 mM EDTA, and 1 mM MgCl₂

      • Solubilize with appropriate detergent (e.g., DDM at 1%)

    3. Functional assessment methods:

      • PSI activity measurements: Oxygen uptake using methyl viologen as electron acceptor

      • 77K fluorescence emission spectra: To determine relative PSI/PSII ratios

      • Western blotting: To quantify PSI subunits and Ycf4 protein levels

      • Blue Native-PAGE: To analyze intact PSI complexes and assembly intermediates

      • Sucrose gradient ultracentrifugation: To separate photosystem complexes

    4. Association analysis:

      • Immunoprecipitation with anti-Ycf4 antibodies

      • Analysis of co-precipitated proteins by mass spectrometry

    These protocols allow researchers to determine whether Ycf4 is properly associating with PSI assembly intermediates and contributing to functional PSI complex formation .

Advanced Research Questions

  • What are the structural differences between the carboxyl and amino termini of Ycf4 that explain their differential roles in protein-protein interactions?

    The differential roles of Ycf4's termini in protein-protein interactions reflect important structural distinctions:

    Terminal RegionStructural FeaturesInteraction StrengthH-Bond Formation
    Amino TerminusMore hydrophilic, contains conserved charged residuesStronger interaction with psaB (5 H-bonds), psbE, and ribosomal proteins (rps2, rps16, rrn16)Forms 14-18 H-bonds with ribosomal proteins
    Carboxyl TerminusMore hydrophobic, contains conserved aromatic residuesStronger interaction with psaH (12 H-bonds), psbC (13 H-bonds), atpB (28 H-bonds) and rpoB (25 H-bonds)Forms significantly more H-bonds with photosynthetic proteins

    The carboxyl terminus demonstrates particularly strong interactions with light-harvesting complex proteins (LHCA1-4) and RUBISCO, forming numerous hydrogen bonds. These structural differences suggest that while both termini are involved in protein interactions, they serve distinct roles in the PSI assembly process, with the carboxyl terminus being more crucial for photosynthesis .

    Molecular docking studies indicate the carboxyl terminus contains binding surfaces optimized for interaction with core PSI components, while the amino terminus may be more involved in initial recognition events or interactions with ribosomal components that could link translation and assembly processes .

  • How does the absence of specific chloroplast genes in G. parvifolium affect research approaches to studying Ycf4 function?

    The absence of 17 coding genes from G. parvifolium's chloroplast genome creates unique challenges and opportunities when studying Ycf4 function:

    1. Compensatory mechanisms: Researchers must investigate potential nuclear-encoded factors that might compensate for missing chloroplast genes, possibly affecting Ycf4 function.

    2. Modified experimental design: Standard chloroplast transformation protocols must be adapted:

      • Homologous recombination targeting must account for altered gene organization

      • Selection markers must be chosen based on genes still present in the plastome

      • Transformation efficiency may differ due to the compact nature of Gnetum plastomes

    3. Comparative approaches: Studies should include:

      • Parallel experiments in model systems with complete chloroplast genomes

      • Analysis of Ycf4 function in other Gnetales vs. distant plant lineages

      • Investigation of nuclear-encoded factors that might interact with Ycf4 in the absence of certain plastid-encoded partners

    4. Functional complementation: Test whether G. parvifolium Ycf4 can rescue Ycf4-deficient mutants in other species with complete chloroplast genomes.

    5. Transcriptome analysis: Essential to understand potential nuclear-encoded compensatory mechanisms for missing chloroplast functions .

    These adaptive research approaches can leverage the unique evolutionary context of G. parvifolium to gain insights into PSI assembly pathways that might not be apparent in model systems with conventional chloroplast genomes .

  • What factors influence recombination events in the plastid genome of G. parvifolium and how might they affect Ycf4 expression?

    Recombination events in G. parvifolium's plastid genome are influenced by several factors that may impact Ycf4 expression:

    1. Presence of inverted repeats (IRs): While G. parvifolium's specific IR structure isn't fully detailed in the search results, studies in related gymnosperms like Juniperus show that even short IRs (244-257 bp) can promote homologous recombination, creating isomeric forms of the plastome .

    2. Substoichiometric shifting: As demonstrated in Juniperus species, plant plastomes can exist in multiple conformations within a single individual, with predominant and substoichiometric forms. Detection methods include:

      • Southern blotting (detects predominant forms)

      • Semi-quantitative PCR with variable cycle numbers (can detect forms at 0.8-5.0% frequency)

      • Illumina paired-end read mapping (precise quantification of rare conformations)

    3. Potential mechanisms affecting Ycf4 expression:

      • If recombination events alter the relative position of ycf4 with respect to promoters or regulatory elements

      • If ycf4 is located near IR boundaries or rearrangement hotspots

      • If isomeric forms affect the efficiency of transcription or processing of polycistronic transcripts

    4. Evolutionary implications: The compact nature of the Gnetum plastome due to reduction of intron and spacer regions may affect the frequency and location of recombination events, potentially stabilizing gene arrangement around essential genes like ycf4.

    Understanding these mechanisms is crucial for interpreting experimental results related to Ycf4 expression and function in G. parvifolium, particularly when designing chloroplast transformation experiments .

  • How can researchers differentiate between direct and indirect effects when studying the impact of Ycf4 mutations on photosynthetic parameters in G. parvifolium?

    Differentiating between direct and indirect effects of Ycf4 mutations requires sophisticated experimental approaches:

    1. Temporal analysis of molecular events:

      • Track PSI subunit synthesis, accumulation, and complex formation over time following induction of mutations

      • Use pulse-chase protein labeling to follow newly synthesized PSI polypeptides

      • Monitor chlorophyll biosynthesis and insertion into PSI complexes

    2. Genetic complementation strategies:

      • Develop truncated Ycf4 variants to determine which domains are critical

      • Use site-directed mutagenesis to modify specific residues identified in docking studies

      • Create chimeric Ycf4 proteins combining domains from species where Ycf4 is essential vs. non-essential

    3. Multi-level phenotyping approach:

      Parameter LevelDirect Effect MetricsIndirect Effect MetricsAnalytical Method
      MolecularPSI subunit accumulation, PSI complex integrityChanges in gene expression, secondary metabolite productionWestern blotting, Blue Native-PAGE, RNA-seq, metabolomics
      BiochemicalPSI activity, electron transport ratePSII activity, ATP synthase functionOxygen evolution, chlorophyll fluorescence, spectroscopic assays
      PhysiologicalLeaf-level photosynthetic parametersPlant growth, stress responsesGas exchange measurements, growth analysis
    4. Controlled environmental conditions:

      • Assess phenotypes under varying light intensities

      • Test impact of temperature stress

      • Evaluate high/low CO₂ conditions

      This approach, when combined with measurements of multiple photosynthetic parameters (Pn, Gs, Ci, Tr, Vpdl, Rc) , can help isolate direct effects of Ycf4 dysfunction from downstream metabolic adjustments.

    5. Use of Ycf4-interacting protein mutants:

      • Compare phenotypes with mutations in proteins directly interacting with Ycf4

      • Analyze double mutants to establish epistatic relationships

    These strategies collectively provide a framework for distinguishing primary defects in PSI assembly from secondary metabolic adjustments in response to impaired photosynthesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.