Recombinant Gnetum parvifolium Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced in E. coli systems, leveraging its prokaryotic compatibility for scalable synthesis .

ParameterDetails
Expression HostE. coli (BL21(DE3) or similar strains)
TagN-terminal His-tag for nickle-affinity chromatography
Purity>90% (SDS-PAGE analysis)
StorageLyophilized powder stored at -20°C/-80°C; reconstituted in Tris-based buffer with 50% glycerol
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol stabilizes long-term storage

PSII Biogenesis and Chlorophyll Insertion

The Gnetum parvifolium psbB protein serves as a model for studying chlorophyll incorporation during PSII assembly. Studies in Synechocystis and Arabidopsis highlight the role of Pam68, a ribosome-associated protein, in stabilizing nascent CP47 and coordinating chlorophyll insertion during translation . This interaction ensures proper folding and integration into the PSII core complex.

Comparative Functional Studies

The psbB gene exhibits 68–76% DNA/protein homology across species, enabling cross-species functional comparisons :

SpeciesUniProt IDLength (aa)Key Features
Gnetum parvifoliumA6BM29508His-tagged, E. coli-expressed, >90% purity
Spinacia oleraceaP04160508Tris/PBS buffer, 6% trehalose storage
Synechococcus elongatusP3109455.766 kDNative thylakoid localization
Anthoceros formosaeQ85AI7508Hornwort-specific isoform

Functional Disruption Studies

Gene knockout experiments in cyanobacteria (Synechocystis) demonstrate that intact CP47 is essential for PSII activity. Disruption of psbB abolishes PSII function, underscoring its role in stabilizing reaction center chlorophylls .

Challenges and Future Directions

While recombinant psbB proteins enable structural and functional studies, challenges remain:

  • Chlorophyll Reconstitution: Native chlorophyll binding is often incomplete in E. coli-produced versions, limiting in vitro PSII reconstitution efforts .

  • Membrane Integration: Proper folding of transmembrane domains requires optimization of E. coli expression conditions (e.g., temperature, chaperones).

Future research may focus on co-expressing auxiliary proteins (e.g., Pam68) to enhance chlorophyll binding and membrane insertion fidelity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Gnetum parvifolium (Small-leaved jointfir) (Gnetum scandens var. parvifolium)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FILPFMTRLGIKESWGGWSITGESAVNPGLWSYEGVAGAHIVFSGLCFLSAIWHWVYWDL EIFSDPRTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPFGLTGRIQP VSPAWGAEGFDPFVPGGIASHHIAAGLLGIIAGLFHLSVRPPQRLYRGLRMGNIETVLSS SIAAVFFAAFIVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIDRRVRAGLTEKLSLSE AWSRIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHPIFRDKEGNELFVRRMP TFFETFPVVLVNKEGIVKADVPFRRSESKYSVEQVGVTVEFYGGELNGVSFSDPAIVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDIFA GIDPELDAQVEFGAFQKLGDPTTKRQVV
Uniprot No.

Target Background

Function
CP47, a key component of the photosystem II (PSII) core complex, plays a crucial role in chlorophyll binding and catalyzing the primary light-induced photochemical reactions within PSII. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient essential for ATP production.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of CP47 chlorophyll apoprotein in Photosystem II?

CP47 is one of the key large structural components of Photosystem II (PSII) embedded in thylakoid membranes. According to the established PSII model, CP47 functions as a core chlorophyll-binding protein that, along with D1, D2, and CP43, forms the foundation of the PSII complex. The protein contains multiple transmembrane helices that coordinate chlorophyll molecules essential for light harvesting and energy transfer to the reaction center .

In the stepwise assembly of PSII, the CP47 assembly module (CP47m) attaches to the Reaction Center II (RCII) complex to form an intermediate called "RC47," which subsequently incorporates the CP43 module to complete the core complex . This sequential assembly process is critical for proper PSII function and involves numerous auxiliary proteins.

How does CP47 contribute to photosynthetic efficiency in plants?

CP47 serves as an internal antenna system that captures light energy and transfers it to the reaction center of PSII. The protein binds multiple chlorophyll molecules and plays a crucial role in maintaining the structural integrity of the PSII complex. Without properly assembled CP47, plants show severely diminished photosynthetic capacity, as evidenced by studies showing extremely weak PSII synthesis in strains lacking functional CP47m .

Pulse-labeling experiments have demonstrated that deficiencies in CP47 module formation significantly limit the process of PSII assembly, resulting in the accumulation of assembly intermediates like RCIIa and RCII* . This indicates that CP47 is not merely a structural component but a rate-limiting factor in the biogenesis of functional PSII complexes.

What techniques are commonly used to isolate CP47 from plant tissues?

Isolation of CP47 from plant tissues typically involves:

  • Thylakoid membrane isolation through differential centrifugation

  • Solubilization of membrane proteins using mild detergents

  • Separation of protein complexes by native gel electrophoresis or column chromatography

  • Identification of CP47-containing fractions through immunoblotting with specific antibodies

For recombinant studies, researchers often employ 2D CN/SDS-PAGE (Clear Native/Sodium Dodecyl Sulfate-Polyacrylamide Gel Electrophoresis) to separate protein complexes in the first dimension while preserving native interactions, followed by denaturing conditions in the second dimension to visualize individual proteins. This approach has successfully identified CP47 in complex with assembly factors like Pam68 .

What strategies have proven effective for expressing recombinant CP47 from Gnetum parvifolium?

Expressing functional recombinant CP47 presents significant challenges due to its complex membrane protein nature and requirement for coordinated chlorophyll integration. Based on research with related systems, effective strategies include:

Expression Systems Comparison Table:

Expression SystemAdvantagesLimitationsSuccess Rate
E. coliFast growth, high yieldLacks chlorophyll synthesis machineryLow
CyanobacteriaNative photosynthetic apparatusSlower growth than E. coliModerate to High
ChlamydomonasEukaryotic processing, chloroplast transformationComplex transformation protocolsModerate
Plant cell culturesNative post-translational modificationsLower yield, slower growthModerate

The most successful approaches typically involve homologous recombination in photosynthetic organisms like cyanobacteria, which provide the necessary machinery for chlorophyll insertion and proper folding. Expression in heterologous systems requires co-expression of assembly factors such as Pam68, which has been shown to promote chlorophyll loading into the CP47 polypeptide chain .

How can researchers overcome challenges in chlorophyll integration during CP47 recombinant expression?

Successful chlorophyll integration into recombinant CP47 requires:

  • Co-expression of the ribosome-bound protein Pam68, which has been demonstrated to stabilize membrane segments of CP47 and facilitate the insertion of chlorophyll molecules into the translated CP47 polypeptide chain

  • Ensuring proximity to the SecY translocon, as Pam68 binds to ribosomes near this complex to promote proper integration

  • Supplementation with chlorophyll precursors in expression systems with limited chlorophyll synthesis capacity

  • Optimization of light conditions during expression to support chlorophyll synthesis

Research has shown that Pam68 deficiency results in severely reduced CP47 incorporation into functional PSII complexes, suggesting its critical role in chlorophyll loading . A strategic approach involves creating fusion constructs that position Pam68 in proximity to nascent CP47 chains during translation.

What is the interplay between transcript abundance and functional CP47 accumulation in Gnetum parvifolium?

The relationship between transcript levels and functional protein accumulation is complex for CP47 in Gnetum parvifolium. Transcriptomic analysis has revealed that many unigenes in G. parvifolium are associated with important secondary metabolism pathways , suggesting that regulatory mechanisms at both transcriptional and post-transcriptional levels influence CP47 expression.

Environmental factors significantly impact both transcript abundance and protein functionality. For instance, high temperature and UV-C exposure have been shown to strongly induce the expression of genes involved in secondary metabolite biosynthesis in G. parvifolium . While this research focused on stilbenoid pathway genes (PAL-, C4H-, 4CL-, and STS-like genes), similar environmental responsiveness may exist for photosynthetic genes including psbB (encoding CP47).

A comprehensive understanding requires simultaneous analysis of transcript levels using qRT-PCR, protein accumulation through immunoblotting, and functional assessment of PSII activity through chlorophyll fluorescence measurements.

How does the CP47 protein from Gnetum parvifolium compare to those from other photosynthetic organisms?

Gnetum represents a small, unique group of Gnetophyta with a controversial phylogenetic position . Comparative analysis of CP47 sequences provides valuable insights into evolutionary relationships and functional conservation across diverse photosynthetic lineages.

While specific comparative data for G. parvifolium CP47 is limited in the provided search results, research on plastid genomes in other plant families such as Geraniaceae has demonstrated that photosynthetic apparatus genes can undergo significant evolutionary changes. These include inversions, expansions/contractions of inverted repeats, and gene duplications .

Key features for comparison include:

  • Sequence conservation in chlorophyll-binding domains

  • Structural elements involved in interactions with other PSII subunits

  • Transit peptide sequences for chloroplast targeting

  • Regulatory elements in the promoter region that respond to environmental cues

Researchers should employ phylogenetic analysis tools to position G. parvifolium CP47 within the broader evolutionary context of land plants and gymnosperms.

What can genome rearrangements in the psbB region tell us about evolutionary processes in Gnetum and related species?

Genome rearrangements, particularly in chloroplast genomes, provide valuable information about evolutionary processes. Although not specific to Gnetum, research on the Geraniaceae family has demonstrated that:

  • Inversions caused by recombination between repeated sequences are considered the main mechanism for changes in gene order in plastid genomes

  • The number of inversions can vary significantly between related genera

  • Some inversions are homoplasious events, suggesting the existence of rearrangement hotspots in the genomes

  • IR expansion and contraction can cause gene duplications, potentially including photosynthetic genes

When studying Gnetum parvifolium specifically, researchers should examine its plastid genome structure surrounding the psbB region for evidence of similar evolutionary mechanisms. Comparative genomic approaches can reveal if psbB has undergone positional changes, duplications, or structural modifications that might reflect adaptation to specific environmental conditions or random genetic drift.

What are the optimal protocols for analyzing CP47-chlorophyll interactions in recombinant systems?

Analyzing CP47-chlorophyll interactions requires sophisticated spectroscopic and biochemical approaches:

Recommended Protocol Sequence:

  • Isolation of CP47-chlorophyll complexes:

    • Purify thylakoid membranes using differential centrifugation

    • Solubilize with mild detergents (β-dodecylmaltoside at 1% w/v)

    • Separate complexes via sucrose gradient ultracentrifugation

  • Spectroscopic analysis:

    • Absorption spectroscopy (400-700 nm) to identify chlorophyll signatures

    • Circular dichroism to assess protein-pigment interactions

    • Time-resolved fluorescence to measure energy transfer efficiency

  • Biochemical characterization:

    • Pigment extraction and HPLC analysis to identify bound chlorophyll species

    • Mass spectrometry to determine stoichiometry of protein:chlorophyll ratio

    • Cross-linking studies to identify specific chlorophyll-binding residues

Evidence from related research on PSII assembly indicates that the PsbH protein creates a network of hydrogen bonds with the stromal loops connecting the first four helices of CP47, potentially fixing the nascent CP47 in a position that facilitates prompt insertion of chlorophyll molecules . Similar structural considerations should guide analysis of recombinant G. parvifolium CP47.

How can researchers effectively study the assembly kinetics of CP47 into functional PSII complexes?

Studying CP47 assembly kinetics requires time-resolved approaches that track the formation of intermediate complexes:

  • Pulse-chase labeling:

    • Radioactively label newly synthesized proteins (typically with 35S-methionine)

    • Chase with unlabeled methionine at defined time points

    • Isolate complexes and analyze by 2D CN/SDS-PAGE

    • Quantify labeled proteins by phosphorimaging

  • Inducible expression systems:

    • Create constructs with inducible promoters controlling CP47 expression

    • Initiate expression and sample at regular intervals

    • Track assembly progression through immunoblotting or fluorescence tagging

  • In vitro reconstitution:

    • Purify individual components (CP47, chlorophyll, assembly factors)

    • Combine under controlled conditions

    • Monitor complex formation through native gel electrophoresis or light scattering

Research has demonstrated that deficiency in proteins like Pam68 results in less labeled CP47 and CP43 in total, and a lack of unassembled CP47, along with severe accumulation of RCIIa and RCII* assembly intermediates . This approach has successfully identified rate-limiting steps in the PSII assembly process.

What analytical techniques best characterize the structural integrity of recombinant CP47?

Multiple complementary techniques provide comprehensive assessment of recombinant CP47 structural integrity:

Structural Analysis Techniques:

TechniqueInformation ProvidedResolution LevelSample Requirements
Circular DichroismSecondary structure contentLowPurified protein (0.1-1 mg/ml)
FTIR SpectroscopySecondary structure elements in membrane environmentMediumConcentrated protein in lipid environment
Limited ProteolysisSurface accessibility, domain organizationMediumPartially purified protein
Cryo-EM3D structure, protein-pigment arrangementHighHighly purified complex (3-5 mg/ml)
X-ray CrystallographyAtomic resolution structureVery HighDiffraction-quality crystals
Mass SpectrometryIntact mass, post-translational modificationsHighPurified protein

For CP47 specifically, researchers should pay particular attention to chlorophyll binding, as improper chlorophyll integration compromises structural integrity. Native mass spectrometry can determine if the expected number of chlorophyll molecules are bound, while thermal stability assays can assess whether the recombinant protein exhibits the high stability characteristic of properly assembled chlorophyll-binding proteins.

What are common pitfalls in recombinant CP47 expression and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant CP47:

Challenge 1: Protein Misfolding and Aggregation

  • Solution: Co-express molecular chaperones specific to chlorophyll-binding proteins; optimize expression temperature (typically lower temperatures reduce aggregation); include compatible solutes like glycine betaine in growth media

Challenge 2: Insufficient Chlorophyll Integration

  • Solution: Ensure co-expression of Pam68, which stabilizes membrane segments of CP47 and facilitates chlorophyll insertion ; supplement growth media with chlorophyll precursors; optimize light conditions during expression

Challenge 3: Proteolytic Degradation

  • Solution: Include protease inhibitors during all purification steps; create fusion constructs with stabilizing domains; optimize extraction and purification buffers to maintain native-like environments

Challenge 4: Low Yield

  • Solution: Test multiple expression hosts; optimize codon usage for the chosen expression system; consider using stronger promoters or inducible systems that can be activated after sufficient biomass accumulation

Evidence from research on CP47 assembly indicates that the absence of key assembly factors results in severe accumulation of assembly intermediates , suggesting that co-expression strategies addressing multiple aspects of CP47 biogenesis simultaneously may prove most effective.

How should researchers interpret conflicting results between transcriptomic and proteomic analyses of CP47?

Discrepancies between transcript and protein levels are common in complex biological systems and require careful interpretation:

  • Verify measurement accuracy:

    • Confirm primer specificity for qRT-PCR targeting psbB

    • Validate antibody specificity for CP47 detection

    • Rule out technical artifacts in both methodologies

  • Consider post-transcriptional regulation:

    • Analyze mRNA stability and half-life

    • Examine translational efficiency through polysome profiling

    • Assess post-translational modifications that might affect protein stability

  • Evaluate assembly state effects:

    • Distinguish between unassembled CP47 and CP47 incorporated into PSII

    • Quantify assembly intermediates that might contain partially processed CP47

  • Investigate temporal dynamics:

    • Implement time-course experiments to detect potential delays between transcription and protein accumulation

    • Consider circadian rhythms that might affect synthesis patterns

Research has shown that environmental factors like high temperature and UV-C can strongly induce gene expression in Gnetum parvifolium , suggesting that transcriptomic and proteomic sampling under identical conditions is essential for meaningful comparisons.

What emerging technologies hold promise for advancing our understanding of CP47 function in Gnetum parvifolium?

Several cutting-edge technologies are poised to revolutionize research on CP47:

  • CRISPR-Cas9 Genome Editing:

    • Creation of precise mutations in the psbB gene to study structure-function relationships

    • Development of tagged variants for in vivo tracking without disrupting function

    • Generation of conditional knockdowns to study temporal aspects of CP47 function

  • Single-Molecule Techniques:

    • Fluorescence resonance energy transfer (FRET) to study energy transfer within PSII

    • Atomic force microscopy to examine CP47 arrangement in membrane complexes

    • Single-particle cryo-EM to resolve structural heterogeneity in PSII assembly intermediates

  • Advanced Microscopy:

    • Super-resolution microscopy to visualize CP47 distribution in thylakoid membranes

    • Correlative light and electron microscopy to connect functional and structural data

    • Live-cell imaging with chlorophyll fluorescence to track assembly dynamics

  • Systems Biology Approaches:

    • Multi-omics integration to connect genotype, transcriptome, proteome, and phenotype

    • Metabolic flux analysis to quantify the impact of CP47 variants on photosynthetic efficiency

    • Machine learning to identify subtle patterns in large-scale data sets

These technologies, when applied to Gnetum parvifolium as a unique evolutionary lineage, could provide novel insights into both fundamental aspects of photosynthesis and lineage-specific adaptations.

What collaborative research approaches might accelerate progress in understanding CP47 in Gnetum parvifolium?

Interdisciplinary collaboration offers tremendous potential for advancing CP47 research:

Recommended Collaborative Framework:

  • Evolutionary Biologists + Structural Biologists:

    • Compare CP47 structures across diverse photosynthetic lineages

    • Identify conserved vs. variable regions that might reflect functional constraints

    • Map evolutionary changes onto structural models to understand selective pressures

  • Plant Physiologists + Biochemists:

    • Connect CP47 variants to whole-plant photosynthetic performance

    • Identify environmental conditions that modulate CP47 function

    • Develop in vitro systems that recapitulate in vivo observations

  • Computational Biologists + Experimental Scientists:

    • Develop predictive models of CP47 assembly and function

    • Design experiments to test model predictions

    • Refine models based on experimental outcomes

  • Traditional Medicine Experts + Molecular Biologists:

    • Explore potential connections between medicinal properties of Gnetum parvifolium and its photosynthetic apparatus

    • Investigate if secondary metabolites interact with photosynthetic complexes

    • Determine if photosynthetic efficiency correlates with medicinal compound production

Gnetum parvifolium is already recognized as an important Chinese traditional medicinal plant rich in bioactive compounds such as flavonoids and stilbenoids . Understanding the relationship between its unique photosynthetic apparatus and secondary metabolite production could open new research avenues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.