Recombinant Gnetum parvifolium Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Gnetum parvifolium Photosystem Q(B) Protein

The Recombinant Gnetum parvifolium Photosystem Q(B) protein is a recombinant form of a protein involved in photosynthesis, specifically within the photosystem II (PSII) complex. This protein plays a crucial role in the electron transport chain during photosynthesis, facilitating the transfer of electrons from the QA to QB site in the D1 protein of PSII. Despite its importance, detailed information on this specific recombinant protein from Gnetum parvifolium is limited, and it is not commercially available as per some sources .

Structure and Function

The Photosystem Q(B) protein, often associated with the D1 protein in PSII, is essential for photosynthetic electron transport. The D1 protein contains the QB binding site, which is crucial for the electron transfer process . The structure of this protein typically includes several transmembrane helices and a stromal loop where the QB site is located.

Protein CharacteristicsDescription
SpeciesGnetum parvifolium
Protein TypeRecombinant Protein
Tag TypeDetermined during production
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C or -80°C

Research Findings

Research on the QB binding site in the D1 protein has shown that mutations in this region can significantly affect photosynthetic efficiency. For example, substitutions at the Ala251 residue in the D1 protein of Chlamydomonas reinhardtii have varying effects on photosynthesis and D1 turnover . While specific studies on Gnetum parvifolium Photosystem Q(B) protein are scarce, understanding its role in PSII function is crucial for broader insights into photosynthesis.

Comparison with Similar Proteins

Other organisms like Synechococcus elongatus have well-characterized Photosystem Q(B) proteins, such as the PSII D1 protein 2, which is also known as Photosystem II Q(B) protein 2 . This protein is expressed in E. coli and has a His tag for purification.

Protein ComparisonGnetum parvifoliumSynechococcus elongatus
SpeciesGnetum parvifoliumSynechococcus elongatus
Expression HostNot specifiedE. coli
TagDetermined during productionHis tag
Protein LengthNot specifiedFull Length (1-344aa)

References ELISA Recombinant Gnetum parvifolium Photosystem Q(B) protein. Biophysical, biochemical, and physiological characterization of the QB binding site in the D1 protein of photosystem II. Multi-omics Study of Planobispora rosea. Recombinant Full Length Photosystem Q(B) Protein 2 Protein, His-Tagged. ACCLIMATION OF PHOTOSYNTHESIS TO THE ENVIRONMENT 1. Chromosome-level genome assembly of Gynostemma pentaphyllum provides insights into gypenoside biosynthesis. Identification and Roles of Photosystem II Assembly, Stability, and Repair Proteins.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please inform us of any specific tag requirements; we will prioritize development accordingly.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Gnetum parvifolium (Small-leaved jointfir) (Gnetum scandens var. parvifolium)
Target Names
psbA
Target Protein Sequence
MTAILERRESASVWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVAGSLLYGNNIISGAIIPTSAAIGLHFYPIWEASSVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTESESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP formation. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several downstream electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Gnetum parvifolium Photosystem Q(B) protein and what are its basic properties?

Gnetum parvifolium Photosystem Q(B) protein, also known as Photosystem II protein D1, is a 32 kDa thylakoid membrane protein encoded by the psbA gene . This protein is a crucial component of the Photosystem II complex in G. parvifolium, a gymnosperm belonging to the Gnetales order. The protein spans the expression region 1-344 and functions as part of the electron transport chain in photosynthesis .

The protein's amino acid sequence is characterized by transmembrane domains that anchor it within the thylakoid membrane. The full sequence includes critical binding sites for cofactors involved in electron transport during photosynthesis . Its molecular structure enables it to participate in the light-dependent reactions, specifically in the binding and processing of plastoquinone at the QB site.

How does the photosynthetic efficiency of Gnetum parvifolium compare to other plant species?

Studies have demonstrated that Gnetum species, including G. parvifolium, exhibit notably lower photosynthetic efficiency compared to other seed plants . Specifically, G. parvifolium has a mean photosynthetic rate (Pn) of approximately 1.3 ± 0.33 μmol m⁻² s⁻¹ CO₂, which is significantly lower than co-occurring plant species measured under identical conditions .

This reduced photosynthetic efficiency is consistent across various Gnetum species and is believed to be related to the evolutionary adaptations of these plants to their specific ecological niches. The measurements were conducted under controlled conditions with temperature around 30°C, photosynthetic photon flux density between 850 and 950 μmol m⁻² s⁻¹, and ambient CO₂ levels around 400 μmol mol⁻¹ .

What structural features distinguish the Photosystem Q(B) protein in Gnetum parvifolium from other photosynthetic organisms?

While the core function of Photosystem Q(B) protein is conserved across photosynthetic organisms, G. parvifolium's version exhibits several unique structural features. The protein contains specific transmembrane domains and binding sites that may contribute to its adaptation to the plant's habitat and evolutionary history.

The amino acid sequence (MTAILERRESASVWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVAGSLLYGNNIISGAIIPTSAAIGLHFYPIWEASSVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTESESANAGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA) reveals functional domains that interact with other photosystem components . These structural features may play a role in the lower photosynthetic efficiency observed in Gnetum species compared to other seed plants.

What are the optimal storage and handling conditions for Recombinant G. parvifolium Photosystem Q(B) protein?

For optimal preservation of Recombinant G. parvifolium Photosystem Q(B) protein activity, researchers should store the protein at -20°C for routine use, or at -80°C for extended storage periods . The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized specifically for this protein's stability .

To minimize protein degradation, researchers should avoid repeated freeze-thaw cycles. When working with the protein, it is advisable to prepare small working aliquots that can be stored at 4°C for up to one week . When preparing dilutions or working solutions, use buffers that maintain pH stability and include appropriate protease inhibitors to prevent degradation by endogenous proteases.

What techniques are recommended for studying Q(B) protein interactions with other Photosystem II components?

Several techniques have proven effective for studying the interactions between Q(B) protein and other Photosystem II components:

  • Mild solubilization and Blue Native PAGE (BN-PAGE): Thylakoid membranes can be solubilized using a combination of 0.5% digitonin and 0.5% α-DM, followed by separation of protein complexes on 4-16% BN-PAGE. This technique allows for the identification of different forms of PSII complexes including supercomplexes, core dimers, core monomers, and RC47 .

  • Protein crosslinking with glutaraldehyde (GA): This approach can confirm direct interactions between proteins. Thylakoid membranes can be solubilized in 1% α-DM and 1% Digitonin, then loaded on sucrose gradients with or without GA for ultracentrifugation . The resulting fractions can be analyzed to identify protein-protein interactions.

  • Immunoblot analysis: Antibodies against specific proteins like D1 (of which Q(B) is a part) and PsaD can be used to identify PSII and PSI complexes respectively in separated protein fractions .

How can researchers effectively measure the redox properties of the Photosystem Q(B) protein?

To effectively measure the redox properties of Photosystem Q(B) protein, researchers can employ several methodological approaches:

  • EPR spectroscopy: Electron Paramagnetic Resonance spectroscopy can be used to detect and characterize the semiquinone radical QB- − formed during electron transfer. This technique provides direct measurement of the semiquinone state and can be used in redox titrations to determine the redox potentials of the QB/QB- − couple .

  • Equilibrium redox titrations: These experiments involve poising samples at defined redox potentials and quantifying the formation of QB- − at each potential. The resulting data can be analyzed to determine the midpoint potentials (Em) for the redox couples QB/QB- − and QB- −/QBH2 .

  • FTIR spectroscopy: Fourier Transform Infrared spectroscopy has been used to monitor QB- − formation upon illumination by a single flash as a function of applied potential, though this method measures the ability to form QB- − rather than directly measuring the semiquinone itself .

When performing these measurements, it is crucial to carefully control experimental conditions, as the stability of the semiquinone can be affected by pH, temperature, and the presence of other redox-active components.

How do the redox properties of G. parvifolium Photosystem Q(B) protein compare to those in other photosynthetic organisms?

The redox properties of Photosystem Q(B) proteins show interesting variations across different photosynthetic organisms, which provide insights into evolutionary adaptations:

In photosynthetic organisms generally, the semiquinone form (QB- −) has been shown to be thermodynamically stable in various species, though the exact midpoint potentials (Em) differ between species . For example, studies in purple bacterial reaction centers from species like Rhodobacter sphaeroides, Chromatium vinosum, and Blastochloris viridis have demonstrated the presence of a stable semiquinone, with approximately 30-50% of total quinone forming as stable semiquinone during redox titrations .

While specific values for G. parvifolium have not been directly reported in the search results, the general principle in photosynthetic organisms is that the high potential of the QB/QB- − couple (around 90 mV in some species) makes QB- − a poor reductant for O2, which helps explain its remarkable stability and long lifetime in the presence of oxygen .

What evolutionary adaptations in the Photosystem Q(B) protein might explain Gnetum's distinct photosynthetic characteristics?

The distinctly lower photosynthetic efficiency of Gnetum species compared to other seed plants may be partially explained by evolutionary adaptations in the Photosystem Q(B) protein:

The evolutionary history of Gnetales, which includes Gnetum, places them in an interesting position among gymnosperms, and their photosynthetic adaptations may reflect their specific evolutionary trajectory and ecological adaptations .

What methodologies can be used to investigate the thermodynamic stability of QB- − in G. parvifolium compared to other species?

To investigate the thermodynamic stability of QB- − in G. parvifolium compared to other species, researchers can employ several sophisticated approaches:

  • Redox titration with spectroscopic monitoring: Perform carefully controlled redox titrations while monitoring the formation of QB- − using EPR spectroscopy. The resulting data can be fitted to the Nernst equation to determine the midpoint potentials of both the QB/QB- − and QB- −/QBH2 couples . This approach has successfully revealed that QB- − is thermodynamically stable in various photosynthetic organisms, contradicting some previous reports .

  • Temperature-dependent stability analysis: Conduct experiments at different temperatures to determine the enthalpy and entropy components of the free energy of QB- − formation, providing deeper insights into the thermodynamic basis of its stability.

  • Comparative mutation analysis: Introduce site-directed mutations to key residues in the QB binding pocket based on sequence comparisons between G. parvifolium and other species, then measure how these mutations affect the thermodynamic stability of QB- −.

  • Computational modeling: Use molecular dynamics simulations and quantum mechanical calculations to predict the energetics of electron transfer to and from QB in different species, helping to explain observed differences in stability.

How does the Photosystem Q(B) protein interact with the APE1 protein and what methodologies can explore this interaction?

The APE1 protein (Acclimation of Photosynthesis to the Environment 1) has been found to interact with the Photosystem II core complex, of which Q(B) protein is a critical component . To explore this interaction specifically with G. parvifolium Q(B) protein, researchers can employ the following methodologies:

  • Co-immunoprecipitation assays: Using antibodies against either APE1 or Q(B) protein to pull down protein complexes, followed by immunoblotting to detect the presence of interacting partners.

  • Split-reporter protein complementation: Fusing fragments of a reporter protein (like luciferase or GFP) to APE1 and Q(B) protein, which will generate a signal when the proteins interact.

  • Crosslinking followed by mass spectrometry: Using chemical crosslinkers to stabilize protein-protein interactions, followed by proteolytic digestion and mass spectrometry to identify crosslinked peptides and map interaction interfaces.

  • Yeast two-hybrid screening or bimolecular fluorescence complementation: These techniques can confirm direct protein-protein interactions and potentially identify the specific domains involved.

Studies with APE1 mutants have shown impaired growth in high light conditions, especially on minimal medium, which improved with CO2 addition . This suggests that APE1 plays a role in photosynthetic acclimation related to light and CO2 availability, potentially through its interaction with Photosystem II components including the Q(B) protein.

How can researchers address the contradictory findings regarding QB- − stability in different studies?

Addressing contradictory findings regarding QB- − stability requires careful experimental design and consideration of methodological differences:

  • Methodological standardization: Different techniques (EPR, FTIR, etc.) may yield different results. Researchers should directly compare multiple techniques on the same sample preparation to identify methodological biases .

  • Sample preparation considerations: The stability of QB- − can be affected by the method of thylakoid membrane isolation and solubilization. Standardizing these procedures across studies can help resolve contradictions.

  • Reconciliation of direct vs. indirect measurements: Some techniques directly measure QB- −, while others measure the ability to form QB- − upon illumination. Understanding this distinction is crucial for interpreting seemingly contradictory results. For example, a recent study using FTIR to monitor QB- − formation showed no evidence for stable QB- − formation, while direct EPR measurements demonstrated its thermodynamic stability .

  • Control experiments with free plastoquinone: Some studies may inadvertently measure the redox properties of free plastoquinone rather than bound QB. Even PSII cores without membranes contain 1-2 free quinones that can act as a limited plastoquinone pool . Proper controls and sample characterization can help distinguish these signals.

What novel applications might G. parvifolium Photosystem Q(B) protein have in bioenergetics research?

G. parvifolium Photosystem Q(B) protein represents an interesting model for several potential applications in bioenergetics research:

  • Biohybrid solar cells: The unique properties of G. parvifolium Q(B) protein, particularly its redox characteristics, could be exploited in the development of bio-inspired solar energy conversion devices. Understanding how this protein functions despite the lower photosynthetic efficiency of Gnetum species may provide insights for designing more robust artificial photosynthetic systems.

  • Stress tolerance mechanisms: Given that Gnetum species have adapted to various ecological niches while maintaining lower photosynthetic rates, studying their Q(B) protein may reveal novel mechanisms for balancing energy conversion efficiency with stress tolerance, which could be valuable for engineering crops with enhanced resilience.

  • Evolutionary models: As a member of the Gnetales, G. parvifolium occupies an interesting position in plant evolution. Comparative studies of its Q(B) protein with those from other plant lineages could provide insights into the evolutionary history of photosynthesis and inform molecular clock analyses.

What specific experimental setups would best elucidate the relationship between Q(B) redox potential and photosynthetic efficiency in G. parvifolium?

To elucidate the relationship between Q(B) redox potential and photosynthetic efficiency in G. parvifolium, researchers could employ the following experimental setups:

  • Combined redox titration and photosynthetic measurements: Simultaneously measure QB- − formation using EPR spectroscopy while monitoring photosynthetic electron transport rates under various light intensities and CO2 concentrations.

  • Site-directed mutagenesis of the QB binding pocket: Create recombinant versions of G. parvifolium Q(B) protein with specific amino acid substitutions predicted to alter the redox potential, then measure both the altered redox properties and resulting changes in photosynthetic efficiency.

  • Comparative analysis across growth conditions: Grow G. parvifolium under varying light intensities, CO2 concentrations, and temperatures, then isolate thylakoid membranes to determine if the QB redox properties change in response to environmental conditions and correlate with photosynthetic performance.

  • Heterologous expression systems: Express G. parvifolium Q(B) protein in model organisms like cyanobacteria or Chlamydomonas with their native D1 protein knocked out, then measure how the substitution affects both redox properties and photosynthetic performance.

How might the study of G. parvifolium Photosystem Q(B) protein contribute to understanding photosynthetic adaptations to environmental stress?

The study of G. parvifolium Photosystem Q(B) protein could significantly advance our understanding of photosynthetic adaptations to environmental stress through several research avenues:

  • Comparative stress response analysis: Exposing G. parvifolium to various stressors (high light, drought, temperature extremes) and measuring changes in Q(B) protein abundance, modification, and function could reveal how this protein contributes to stress adaptation.

  • Role in reactive oxygen species (ROS) management: The high potential of the QB/QB- − couple in photosynthetic organisms makes QB- − a poor reductant for O2, potentially reducing ROS formation . Investigating whether G. parvifolium has evolved specific modifications to this mechanism could provide insights into stress tolerance strategies.

  • Integration with transcriptomic data: Combining functional studies of the Q(B) protein with transcriptomic analyses (similar to those performed on G. luofuense ) could reveal how regulation of this protein coordinates with broader acclimation responses, particularly in pathways like "photosynthesis," "phenylpropanoid biosynthesis," and "plant hormone signal transduction" that have been shown to be important in Gnetum species .

  • Engineered variations for stress testing: Creating transgenic plants with modified versions of the G. parvifolium Q(B) protein could help test hypotheses about how specific features contribute to stress tolerance, potentially leading to applications in crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.