Recombinant Goat Acyl-CoA desaturase (SCD)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics and Function

Recombinant Goat SCD retains the core functional attributes of native SCD, including:

  • Catalytic Activity: Introduces a cis double bond at the Δ9 position of fatty acyl-CoA substrates (e.g., stearoyl-CoA to oleoyl-CoA) .

  • Cofactor Requirements: Relies on molecular oxygen, NADH, cytochrome b5 reductase, and cytochrome b5 for electron transfer during desaturation .

  • Subcellular Localization: Functions in the endoplasmic reticulum (ER) membrane .

Research Applications:

  • Lipid Metabolism Studies: Investigating MUFA synthesis pathways and their impact on cellular functions .

  • Therapeutic Target Screening: Evaluating SCD inhibitors for obesity, diabetes, or cancer .

Table 1: Key Functional Attributes of Recombinant SCD

ParameterObservationSource
Enzyme ActivityTime-dependent oscillation pattern in granulosa cells
Substrate PreferenceHigher activity toward stearoyl-CoA vs. palmitoyl-CoA
Regulatory ImpactUpregulates ACACA, FASN, and DGAT1 genes in lipid synthesis
Polymorphism EffectsSNPs in exon 6 alter amino acid residues (e.g., Arg350→Ser)

Table 2: Metabolic Pathways Influenced by SCD Overexpression/Knockdown

PathwayEffect of SCD OverexpressionEffect of SCD Knockdown
Triglyceride SynthesisIncreased TAG contentDecreased TAG content
Lipid Oxidation GenesDownregulated (e.g., CPT1A)Upregulated
Cholesterol MetabolismEnhanced esterificationReduced synthesis
Data synthesized from buffalo and goat studies .

Genetic Variability and Implications

  • Polymorphisms: Six SNPs identified in goat SCD, including exon 6 variants (e.g., 690A→G) linked to altered enzyme function .

  • Breed-Specific Variations: Allelic frequencies differ between Xuhuai, Boer, and Haimen goats, suggesting adaptive or selective pressures .

Therapeutic and Industrial Relevance

  • Metabolic Diseases: SCD deficiency correlates with reduced adiposity and improved insulin sensitivity, making it a target for obesity therapies .

  • Dairy Science: Recombinant SDC aids in studying milk fat synthesis mechanisms in ruminants .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have a specific format preference, please indicate your requirement during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SCD; Stearoyl-CoA desaturase; Acyl-CoA desaturase; Delta(9-desaturase; Delta-9 desaturase; Fatty acid desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-359
Protein Length
Full Length of Mature Protein
Species
Capra hircus (Goat)
Target Names
SCD
Target Protein Sequence
PAHLLQEEISSSYTTTTTITAPPSKVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPTYQD KEGPKPKLEYVWRNIILMGLLHLGALYGITLIPTCKIYTFLWVLFYYMMSALGITAGVHR LWSHRTYKARLPLRVFLIIANTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFSH VGWLLVRKHPAVREKGATLDLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWGET FQNSLFFATLLRYAVVLNATWLVNSAAHMYGYRPYDKTINPRENILVSLGAVGEGFHNYH HTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAALARMKRTGEESCKSG
Uniprot No.

Target Background

Function
Stearoyl-CoA desaturase utilizes O2 and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. It catalyzes the insertion of a cis double bond at the delta-9 position into fatty acyl-CoA substrates, including palmitoyl-CoA and stearoyl-CoA. This results in a mixture of 16:1 and 18:1 unsaturated fatty acids. It plays a critical role in lipid biosynthesis. This enzyme is also vital in regulating the expression of genes involved in lipogenesis and in regulating mitochondrial fatty acid oxidation. It plays a key role in body energy homeostasis and contributes to the biosynthesis of membrane phospholipids, cholesterol esters, and triglycerides.
Database Links

UniGene: Chi.134

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of goat SCD and how does it compare to SCD from other species?

Goat SCD is a membrane-bound enzyme consisting of 359 amino acids with a molecular weight of approximately 41.58 kDa and an isoelectric point of 9.19. The protein contains 33 negatively charged residues (Asp + Glu) and 42 positively charged residues (Arg + Lys), with a grand average of hydropathicity (GRAVY) of -0.18, indicating it is slightly hydrophilic despite being a membrane protein .

Compared to other species, goat SCD maintains a highly conserved structure. The protein shares significant homology with SCD from other ruminants, particularly sheep (very high similarity), cattle, and buffalo. When comparing physical properties, goat SCD has an instability index of 45.66 and an aliphatic index of 87.49, suggesting a relatively stable protein with a significant proportion of aliphatic side chains .

What are the known polymorphisms in goat SCD gene and how are they distributed?

Genetic analysis of the goat SCD gene has revealed six significant single nucleotide polymorphisms (SNPs). Two SNPs are located in intron 3 (585T→A and 601A→G), one in intron 4 (719T→A), and three in exon 6 (690A→G, 718C→G, and 802A→C) .

The distribution of these polymorphisms varies among different goat breeds. For example, the 601A→G polymorphism shows variability only in Xuhuai and Boer breeds but not in Haimen. Across breeds, the average frequency for the least frequent alleles ranges from 0.1158 to 0.2532. The allelic distribution in exon 6 of the Xuhuai breed differs significantly from that in Boer and Haimen breeds, suggesting potential breed-specific genetic patterns .

How do SCD gene polymorphisms impact amino acid sequence in goats?

The three SNPs identified in exon 6 of the goat SCD gene (690A→G, 718C→G, and 802A→C) result in significant amino acid variations. Specifically, these polymorphisms lead to the following amino acid substitutions:

  • Position 313: tyrosine to cysteine (Tyr → Cys)

  • Position 322: phenylalanine to leucine (Phe → Leu)

  • Position 350: arginine to serine (Arg → Ser)

These amino acid changes are particularly significant because they occur in the functional region of the protein and may affect the enzyme's catalytic activity, substrate specificity, or stability. The substitution from tyrosine to cysteine at position 313 introduces a sulfhydryl group that could potentially form disulfide bonds, while the change from phenylalanine to leucine at position 322 represents a substitution between two hydrophobic amino acids but with different structural properties. The arginine to serine substitution at position 350 represents a change from a positively charged amino acid to a polar uncharged one, which could impact protein-protein interactions or regulatory mechanisms .

What are the recommended methods for cloning and expressing recombinant goat SCD?

For successful cloning and expression of recombinant goat SCD, the following methodological approach is recommended:

  • RNA Extraction and cDNA Synthesis: Extract total RNA from goat mammary tissue using TRIzol or similar reagents. Synthesize cDNA using a reverse transcription kit with oligo(dT) primers.

  • PCR Amplification: Design specific primers targeting the complete coding sequence (CDS) of goat SCD without the stop codon if you plan to add a tag. Use high-fidelity DNA polymerase for amplification with optimal cycling conditions (initial denaturation at 95°C for 5 min, followed by 35 cycles of denaturation at 95°C for 30 sec, annealing at 58-60°C for 30 sec, extension at 72°C for 1-2 min, and final extension at 72°C for 10 min) .

  • Cloning: Ligate the PCR product into a cloning vector (such as pMD18-T) for sequence verification. After confirmation, subclone the SCD sequence into an appropriate expression vector with a tag (such as EGFP) for easy detection and purification .

  • Transformation and Expression: Transform the recombinant vector into a suitable expression system. For mammalian expression, cell lines like HEK293 or CHO are recommended. For bacterial expression, E. coli BL21(DE3) can be used with optimization for membrane protein expression.

  • Verification: Confirm successful expression by Western blot using either SCD-specific antibodies or tag-specific antibodies. Verify protein functionality through enzyme activity assays .

How can researchers effectively analyze SCD polymorphisms in goat populations?

To effectively analyze SCD polymorphisms in goat populations, researchers should follow this comprehensive approach:

  • Sample Collection: Collect blood or tissue samples from diverse goat breeds, ensuring adequate population representation. A sample size of at least 30-50 individuals per breed is recommended for meaningful statistical analysis. The study described in the search results analyzed 335 animals across three goat breeds .

  • DNA Extraction: Extract genomic DNA using standard protocols optimized for caprine samples.

  • PCR Amplification: Design primers flanking regions of interest in the SCD gene. For comprehensive analysis, include exons, introns, and regulatory regions.

  • Polymorphism Detection Methods:

    • Single-Strand Conformation Polymorphism (SSCP): This technique can identify conformational differences in single-stranded DNA due to sequence variations. Run PCR products on non-denaturing polyacrylamide gels under specific conditions to detect mobility shifts .

    • DNA Sequencing: For precise identification of polymorphisms, perform bidirectional Sanger sequencing of PCR products showing variable SSCP patterns.

    • High-throughput Genotyping: For large population studies, consider using SNP arrays or next-generation sequencing approaches.

  • Data Analysis: Calculate allele and genotype frequencies for each polymorphism. Perform statistical analyses to determine Hardy-Weinberg equilibrium, linkage disequilibrium, and breed-specific differences.

  • Functional Prediction: Use bioinformatics tools to predict the potential impact of identified polymorphisms on protein structure and function, particularly for exonic variants resulting in amino acid substitutions .

What cell culture systems are most appropriate for functional studies of recombinant goat SCD?

For functional studies of recombinant goat SCD, several cell culture systems can be employed, each with specific advantages:

  • Mammary Epithelial Cells (MECs): Primary goat mammary epithelial cells or immortalized MEC lines provide the most physiologically relevant system for studying SCD function in milk fat synthesis. These cells maintain the regulatory machinery involved in milk fat metabolism .

  • HEK293 or CHO Cells: These mammalian cell lines offer high transfection efficiency and protein expression levels, making them suitable for producing recombinant SCD for biochemical characterization.

  • Goat Fibroblasts: These can be used for studying the basic enzymatic properties of SCD in a species-specific cellular environment.

  • Hepatocyte Cell Lines (e.g., HepG2): While not of caprine origin, these cells are useful for studying SCD in the context of lipid metabolism, as demonstrated in the Buffalo SCD study methodology .

For optimal results, cell culture conditions should include:

  • DMEM supplemented with 10% FBS, antibiotics, and growth factors

  • For MECs, additional supplements such as insulin (5 μg/mL), hydrocortisone (5 μg/mL), and epidermal growth factor (1 μg/mL)

  • Incubation at 37°C in a humidified atmosphere with 5% CO₂

  • For lactation studies in MECs, induction with prolactin (3 μg/mL)

Transfection protocols should be optimized for the specific cell type, with lipid-based transfection reagents generally working well for mammalian cells expressing membrane proteins like SCD .

How does overexpression of goat SCD affect lipid metabolism pathways in mammary cells?

Overexpression of goat SCD in mammary epithelial cells triggers significant changes in lipid metabolism pathways, primarily by enhancing monounsaturated fatty acid (MUFA) synthesis and subsequently activating multiple downstream targets. Based on comparative research in buffalo mammary epithelial cells (BuMECs), we can infer similar effects in goat cells.

When SCD is overexpressed, it significantly upregulates genes involved in de novo fatty acid synthesis, including ACACA (acetyl-CoA carboxylase alpha) with approximately 3.4-fold increase and FASN (fatty acid synthase) with about 2.2-fold increase. Additionally, genes involved in fatty acid esterification, such as DGAT1 (diacylglycerol O-acyltransferase 1), show enhanced expression (around 2.7-fold) .

Interestingly, SCD overexpression appears to downregulate fatty acid uptake pathways, as evidenced by a substantial decrease (approximately 85%) in CD36 expression, which is involved in fatty acid transport. This suggests that SCD overexpression shifts cellular metabolism toward de novo synthesis rather than uptake of exogenous fatty acids .

Furthermore, SCD overexpression activates key transcriptional regulators of lipid metabolism, including:

  • SREBF1 (sterol regulatory element-binding transcription factor 1): ~2.1-fold increase

  • SREBF2 (sterol regulatory element-binding transcription factor 2): ~3.7-fold increase

  • PPARG (peroxisome proliferator-activated receptor gamma): ~2.8-fold increase

  • SP1 transcription factor: ~1.9-fold increase

The functional consequence of these changes is a significant increase in triacylglycerol (TAG) content (approximately 1.34-fold) in mammary epithelial cells, indicating enhanced lipid synthesis and accumulation .

How do regulatory factors influence goat SCD expression in different physiological states?

The expression of goat SCD is dynamically regulated by various factors across different physiological states, primarily through transcription factors and hormonal influences. Based on comparative studies, several key regulatory mechanisms can be identified:

  • Transcription Factor Regulation:

    • SREBF1 (SREBP-1c) is a major positive regulator of SCD expression. During lactation and high energy intake states, SREBF1 activation leads to increased SCD expression. Conversely, when SREBF1 is inhibited by AMPK activation (during energy-deficient states), SCD expression decreases .

    • PPARG (PPARγ) significantly influences SCD expression in mammary epithelial cells. Studies in goat mammary cells have shown that PPARG activation increases SCD expression, while PPARG knockdown reduces SCD expression by approximately 65% .

    • SP1 transcription factor binds directly to the core promoter region of the SCD gene, regulating its expression particularly in relation to polyunsaturated fatty acid synthesis .

  • Nutritional Regulation:

    • Dietary fatty acid composition significantly impacts SCD expression. High-carbohydrate diets typically increase SCD expression through SREBF1 activation.

    • Even under MUFA-deficient dietary conditions, SCD expression can be upregulated to maintain cellular MUFA balance .

  • Hormonal Regulation:

    • Lactation hormones, especially prolactin, upregulate SCD expression in mammary tissue during lactation.

    • Insulin increases SCD expression through SREBF1 activation, while glucagon tends to reduce SCD expression.

  • Feedback Regulation:

    • SCD expression appears to be subject to feedback regulation, where SCD influences the expression of its own regulatory factors. For example, SCD overexpression increases SREBF1, SREBF2, PPARG, and SP1 expression, while reducing INSIG1 (a negative regulator of SREBF processing) by approximately 65% .

These regulatory mechanisms explain the dynamic expression of SCD during different physiological states such as growth, pregnancy, lactation, and varying nutritional status in goats.

What are the recommended protocols for measuring SCD enzyme activity in goat tissue samples?

For measuring SCD enzyme activity in goat tissue samples, researchers should implement the following comprehensive protocol:

  • Sample Preparation:

    • Collect fresh tissue samples (mammary gland, liver, or adipose tissue) and immediately flash-freeze in liquid nitrogen.

    • Prepare microsomal fractions by homogenizing tissue in buffer (typically 0.25 M sucrose, 10 mM Tris-HCl pH 7.4, 1 mM EDTA) and performing differential centrifugation (10,000×g to remove debris, followed by 100,000×g to isolate microsomes).

    • Resuspend microsomal pellet in storage buffer and determine protein concentration using Bradford or BCA assay.

  • SCD Activity Assay:

    • Substrate Preparation: Prepare [1-¹⁴C]stearoyl-CoA or [1-¹⁴C]palmitoyl-CoA as substrate. Alternative non-radioactive methods can use stable isotope-labeled substrates.

    • Reaction Mixture: Combine microsomes (50-100 μg protein), substrate (50-100 μM), NADH or NADPH (1 mM), and appropriate buffer (typically 0.1 M potassium phosphate, pH 7.2).

    • Incubation: Incubate the reaction mixture at 37°C for 5-30 minutes.

    • Reaction Termination: Stop the reaction by adding acidified methanol or chloroform:methanol (2:1, v/v).

  • Product Analysis:

    • Lipid Extraction: Extract total lipids using Folch method (chloroform:methanol, 2:1) and separate fatty acids.

    • Derivatization: Convert fatty acids to methyl esters using boron trifluoride (14% in methanol) or other appropriate reagents .

    • Analysis by GC or GC-MS: Analyze fatty acid methyl esters by gas chromatography to quantify both substrate (saturated) and product (monounsaturated) fatty acids .

    • Activity Calculation: SCD activity is typically expressed as the ratio of product (e.g., oleic acid) to substrate (e.g., stearic acid) or as nmol product formed per mg protein per minute.

  • Alternative Analytical Methods:

    • HPLC-based assays: For increased sensitivity and specificity.

    • Mass spectrometry: For detailed analysis of multiple fatty acid species simultaneously.

    • Deuterated substrate approach: Using deuterated fatty acids (similar to AA-d₈ or EPA-d₅ mentioned in the search results) for tracking conversion without radioactivity .

  • Controls and Validation:

    • Include positive controls (liver microsomes with known SCD activity) and negative controls (heat-inactivated microsomes).

    • Validate results with selective SCD inhibitors to confirm specificity of the measured activity.

How can researchers effectively analyze the impact of SCD polymorphisms on milk fatty acid composition?

To effectively analyze the impact of SCD polymorphisms on milk fatty acid composition in goats, researchers should implement this comprehensive methodological approach:

What are the optimal expression systems for producing functional recombinant goat SCD for structural studies?

For producing functional recombinant goat SCD suitable for structural studies, researchers should consider several expression systems, each with specific advantages and limitations:

  • Mammalian Expression Systems:

    • HEK293/HEK293T Cells: These cells provide proper post-translational modifications and membrane integration for SCD. Use vectors like pcDNA3.1 or pEGFP-N1 (as mentioned in the search results) with strong promoters (CMV) for high expression .

    • CHO Cells: Offer stable expression and proper folding of complex membrane proteins. Particularly suitable for long-term production and crystallization studies.

    • Benefits: Native-like membrane environment, proper folding, post-translational modifications.

    • Protocol Optimization: Use chemical transfection (calcium phosphate, lipofectamine) or viral transduction. Include selection markers (G418, puromycin) for stable cell line generation. Culture at 37°C in DMEM with 10% FBS and supplements .

  • Insect Cell Systems:

    • Sf9/Sf21 or High Five™ Cells: Combined with baculovirus expression vectors (BEVS), these systems are excellent for membrane protein production.

    • Benefits: Higher yield than mammalian systems, proper folding, cost-effective scaling.

    • Protocol Optimization: Culture at 27°C in appropriate insect cell media. Optimize MOI (multiplicity of infection) and harvest time (typically 48-72 hours post-infection).

  • Yeast Expression Systems:

    • Pichia pastoris: Effective for membrane protein expression with proper folding and disulfide bond formation.

    • Saccharomyces cerevisiae: Useful for functional studies, especially considering the extensive knowledge of lipid metabolism in this organism.

    • Benefits: High yields, eukaryotic processing, ability to grow in fermenter systems.

    • Protocol Optimization: Use strong inducible promoters (AOX1 for P. pastoris, GAL1 for S. cerevisiae). Culture in appropriate minimal media with carbon source control.

  • Cell-Free Expression Systems:

    • Wheat Germ Extract or Rabbit Reticulocyte Lysate: For rapid protein production and initial functional studies.

    • Benefits: Avoids toxicity issues, rapid production, amenable to incorporation of modified amino acids for structural studies.

  • Purification Strategies for Structural Studies:

    • Affinity Tags: Use C-terminal tags (e.g., His6, FLAG, or GFP) to minimize interference with the N-terminal membrane insertion .

    • Detergent Screening: Critical for membrane protein stability. Test multiple detergents (DDM, LMNG, GDN) for optimal extraction and stability.

    • Lipid Nanodisc Reconstitution: For maintaining native-like lipid environment during structural studies.

    • SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering): To verify monodispersity prior to structural studies.

  • Functional Validation:

    • Verify enzyme activity using substrate conversion assays

    • Confirm proper membrane integration by subcellular fractionation

    • Assess oligomeric state, which is critical for proper function

For crystallography or cryo-EM studies, the mammalian or insect cell systems typically provide the highest quality protein, while functional studies may be conducted using any of these systems depending on the specific research questions.

How should researchers interpret contradictory findings in studies of goat SCD polymorphisms and fatty acid profiles?

When confronted with contradictory findings regarding goat SCD polymorphisms and their associations with fatty acid profiles, researchers should implement a systematic approach to interpretation:

  • Methodological Assessment:

    • Evaluate genotyping methods used (SSCP, sequencing, allele-specific PCR), as different techniques vary in sensitivity and specificity .

    • Compare fatty acid analysis protocols, focusing on extraction methods, derivatization procedures, and analytical instrumentation .

    • Assess statistical approaches, particularly whether appropriate models were used to account for confounding variables.

  • Sample Population Analysis:

    • Examine breed differences, as the search results indicate significant variations in allelic distribution between breeds like Xuhuai, Boer, and Haimen .

    • Consider sample size adequacy; underpowered studies may yield inconsistent results.

    • Evaluate whether environmental factors (diet, management, season, lactation stage) were adequately controlled.

  • Genetic Context Considerations:

    • Assess whether studies considered single SNPs versus haplotypes. The collective effect of multiple polymorphisms may differ from individual SNP effects.

    • Investigate potential linkage disequilibrium with other genes involved in fatty acid metabolism.

    • Consider epistatic interactions with other genes in the lipid metabolism pathway.

  • Functional Impact Analysis:

    • Evaluate the predicted functional impact of different polymorphisms. Exonic SNPs causing amino acid substitutions (like the three in exon 6) may have different effects than intronic or regulatory region polymorphisms .

    • For contradictory findings, consider conducting in vitro functional studies of different SCD variants to directly measure enzymatic activity differences.

  • Integration with Gene Expression Data:

    • Correlate polymorphisms with SCD expression levels, as some contradictions may be explained by differential gene expression rather than altered enzyme activity.

    • When comparing studies, note whether gene expression was measured alongside polymorphism and fatty acid analyses.

  • Recommendations for Resolving Contradictions:

    • Conduct meta-analyses when sufficient studies are available.

    • Design validation studies with larger, more diverse populations.

    • Implement multi-omics approaches (genomics, transcriptomics, proteomics, metabolomics) to gain comprehensive insights.

    • Consider environmental interactions through controlled feeding trials with animals of different genotypes.

    • Develop functional assays to directly measure the impact of specific polymorphisms on enzyme activity and substrate specificity.

What are the most promising research directions for understanding the role of recombinant goat SCD in fatty acid metabolism?

The most promising research directions for advancing our understanding of recombinant goat SCD in fatty acid metabolism encompass several innovative approaches:

  • CRISPR/Cas9 Gene Editing Applications:

    • Generate precise SCD variants in cell lines to study the functional impact of specific polymorphisms identified in goat populations.

    • Create knock-in goat models with specific SCD variants to examine phenotypic effects on fatty acid composition in milk and meat.

    • Develop SCD promoter-reporter systems to study transcriptional regulation under various physiological conditions.

  • Multi-omics Integration:

    • Combine genomic, transcriptomic, proteomic, and lipidomic approaches to create comprehensive models of how SCD genetic variants influence the entire lipid metabolism network.

    • Implement systems biology approaches to model metabolic flux through SCD-dependent pathways.

    • Use metabolic labeling with stable isotopes to track the fate of fatty acids in animals with different SCD genotypes.

  • Structural Biology and Protein Engineering:

    • Determine high-resolution structures of goat SCD variants to understand how polymorphisms affect protein conformation and function.

    • Apply molecular dynamics simulations to predict how amino acid substitutions (particularly at positions 313, 322, and 350) impact substrate binding and catalysis .

    • Engineer SCD variants with enhanced activity or altered substrate specificity for biotechnological applications.

  • Regulatory Network Elucidation:

    • Investigate the complex feedback mechanisms between SCD and its transcriptional regulators (SREBF1, SREBF2, PPARG, and SP1) .

    • Study epigenetic regulation of the SCD gene under different physiological and nutritional conditions.

    • Explore the role of non-coding RNAs (microRNAs, lncRNAs) in post-transcriptional regulation of SCD.

  • Translational Research:

    • Develop breeding strategies based on SCD genotypes to produce goat milk with desired fatty acid profiles for improved nutritional value.

    • Investigate the potential health benefits of milk from goats with specific SCD variants, particularly regarding MUFA content.

    • Study how SCD variants influence the sensory properties and technological characteristics of goat dairy products.

  • Advanced Cellular Models:

    • Develop goat mammary organoids that better recapitulate the in vivo environment for studying SCD function.

    • Use co-culture systems to understand SCD's role in the interaction between different cell types in mammary tissue.

    • Apply microfluidic organ-on-chip technology to study dynamic regulation of SCD under changing conditions.

  • Evolutionary and Comparative Studies:

    • Investigate how SCD has evolved across ruminant species and how this relates to adaptation to different dietary environments.

    • Compare the regulatory mechanisms controlling SCD expression across species to identify conserved and divergent features .

How can researchers integrate computational modeling with experimental approaches to study goat SCD structure-function relationships?

Integrating computational modeling with experimental approaches offers powerful insights into goat SCD structure-function relationships. Here's a comprehensive roadmap for this integrated approach:

  • Sequence-Based Computational Analysis:

    • Homology Modeling: Generate 3D structural models of goat SCD based on known structures of mammalian SCD or related desaturases. Include variants with the amino acid substitutions at positions 313, 322, and 350 resulting from the identified polymorphisms .

    • Sequence Conservation Analysis: Identify functionally critical residues through multiple sequence alignment across species, with particular attention to differences between goat and other ruminants shown in the comparative data table .

    • Prediction of Post-translational Modifications: Identify potential phosphorylation, glycosylation, and other modification sites that might regulate SCD activity.

  • Structure-Based Computational Methods:

    • Molecular Dynamics (MD) Simulations: Simulate the behavior of wild-type and variant SCD proteins in membrane environments to assess conformational stability and flexibility.

    • Molecular Docking: Model substrate binding (stearoyl-CoA) and cofactor interactions (NAD(P)H, iron) to predict how polymorphisms affect binding affinity and orientation.

    • Quantum Mechanics/Molecular Mechanics (QM/MM): For detailed modeling of the catalytic reaction mechanism and how amino acid substitutions might alter it.

  • Experimental Validation Approaches:

    • Site-Directed Mutagenesis: Systematically create SCD variants with specific mutations for functional testing, guided by computational predictions .

    • Enzyme Kinetics: Measure kinetic parameters (Km, Vmax, kcat) of wild-type and mutant enzymes to validate computational predictions about substrate binding and catalysis.

    • Thermal Stability Assays: Use differential scanning calorimetry or thermal shift assays to compare the stability of different SCD variants, validating predictions from MD simulations.

  • Structural Biology Techniques:

    • X-ray Crystallography or Cryo-EM: Determine experimental structures of goat SCD in different conformational states or with bound substrates/inhibitors.

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Probe protein dynamics and conformational changes upon substrate binding or in different SCD variants.

    • Cross-linking Mass Spectrometry: Identify interaction interfaces for SCD with partner proteins in the lipid metabolism pathway.

  • Integration Frameworks:

    • Machine Learning Approaches: Train models on experimental data to improve computational predictions about variant effects.

    • Bayesian Networks: Integrate diverse experimental data with computational predictions to build probabilistic models of SCD function.

    • Metabolic Modeling: Incorporate SCD variants into genome-scale metabolic models to predict system-wide effects on lipid metabolism.

  • Iterative Workflow:

    • Start with computational predictions based on sequence data and homology models

    • Design targeted experiments to test specific hypotheses generated by computational modeling

    • Refine computational models based on experimental results

    • Generate new predictions for the next round of experimental validation

  • Advanced Integration:

    • Collaborative Platforms: Implement web-based tools for sharing models and experimental data between research groups.

    • Visualization Tools: Develop integrated visualization of computational models and experimental data for better understanding of structure-function relationships.

    • Automation: Implement automated workflows for high-throughput virtual screening of SCD variants and their potential functional impacts.

This integrated approach maximizes research efficiency by using computational methods to guide experimental design and experimental data to refine computational models, creating a virtuous cycle of discovery.

What are the key considerations for designing comprehensive studies of goat SCD for fatty acid metabolism research?

Designing comprehensive studies of goat SCD for fatty acid metabolism research requires careful consideration of multiple interdependent factors. Researchers should incorporate these key elements into their experimental design:

  • Genetic Diversity Considerations:

    • Include multiple goat breeds with known phenotypic differences in milk and meat fatty acid profiles.

    • Ensure adequate sample size (minimum 30-50 animals per breed) for statistical power.

    • Consider both common breeds and native/indigenous breeds that may harbor unique genetic variants .

  • Comprehensive Genotyping Strategy:

    • Sequence the complete SCD gene, including exons, introns, and regulatory regions (at least 2 kb upstream).

    • Target known polymorphic sites (particularly the six SNPs identified in introns 3, 4, and exon 6) .

    • Consider whole-genome or exome sequencing to identify variants in other genes that may interact with SCD.

  • Multi-level Expression Analysis:

    • Quantify SCD mRNA levels in relevant tissues (mammary gland, adipose tissue, liver).

    • Measure SCD protein abundance using quantitative Western blot or targeted proteomics .

    • Assess SCD enzyme activity using both direct (substrate conversion) and indirect (desaturation index) measurements.

  • Comprehensive Lipid Profiling:

    • Analyze complete fatty acid profiles in milk, meat, and other relevant tissues.

    • Include positional analysis of fatty acids in triacylglycerols.

    • Consider lipidomic approaches to assess broader changes in the lipidome.

  • Environmental Controls and Interactions:

    • Standardize diets and management conditions to minimize environmental variables.

    • Include dietary intervention sub-studies to assess SCD genotype × diet interactions.

    • Account for physiological states (growth, pregnancy, lactation) and their impact on SCD activity.

  • Functional Validation Approaches:

    • Develop cell culture models expressing different SCD variants.

    • Measure impact on lipid metabolism gene networks and TAG accumulation .

    • Consider developing transgenic models for whole-animal validation of key findings.

  • Integrative Data Analysis Framework:

    • Implement mixed models that account for fixed genetic effects and random environmental factors.

    • Use network analysis to understand SCD interactions within the larger metabolic framework.

    • Apply multi-omics data integration approaches to generate comprehensive models.

  • Translational Considerations:

    • Include parameters relevant to product quality (milk and meat).

    • Consider consumer health aspects, such as healthful fatty acid profiles.

    • Assess potential for genetic selection programs based on findings.

  • Methodological Standardization:

    • Follow standardized protocols for sample collection, processing, and analysis.

    • Include appropriate reference materials and controls in all analyses.

    • Apply rigorous statistical analysis with appropriate corrections for multiple testing.

By incorporating these considerations, researchers can design studies that yield comprehensive, reliable, and translatable insights into the role of goat SCD in fatty acid metabolism.

What are the potential applications of engineered goat SCD variants in agricultural and biomedical research?

Engineered goat SCD variants offer diverse and promising applications in both agricultural and biomedical research fields:

  • Agricultural Applications:

    • Enhanced Milk Nutritional Quality: Developing goats with SCD variants that optimize the ratio of unsaturated to saturated fatty acids in milk, potentially creating products with improved nutritional profiles and health benefits.

    • Customized Fatty Acid Profiles: Engineering SCD variants with altered substrate specificity to produce milk with customized fatty acid compositions for specific nutritional needs or manufacturing properties.

    • Improved Meat Quality: Selecting for SCD variants that influence intramuscular fat composition to enhance flavor, tenderness, and nutritional value of goat meat.

    • Breeding Program Enhancement: Utilizing knowledge of SCD polymorphisms and their effects on fatty acid metabolism to develop marker-assisted selection programs for improved production traits .

    • Climate Adaptation: Developing breeds with SCD variants that contribute to physiological adaptation to changing climate conditions through optimized membrane lipid composition.

  • Biomedical Research Applications:

    • Model Systems for Metabolic Disorders: Creating transgenic goats expressing human SCD variants to study metabolic conditions including obesity, insulin resistance, and non-alcoholic fatty liver disease.

    • Therapeutic Protein Production: Using engineered goat mammary gland expression systems incorporating SCD variants to produce milk containing therapeutic proteins with optimized lipid environments for stability.

    • Nutraceutical Development: Producing milk enriched in specific beneficial fatty acids through SCD engineering for development of functional foods or nutraceuticals.

    • Cell Membrane Research: Utilizing engineered SCD variants to study how membrane lipid composition influences cellular functions, including signal transduction and membrane protein activity.

    • Drug Development: Creating screening systems using engineered SCD variants to identify compounds that modulate desaturase activity for potential therapeutic applications in metabolic diseases.

  • Biotechnological Applications:

    • Bioreactor Development: Engineering cell lines with modified SCD for optimized production of specific lipids or lipid-associated compounds.

    • Enzyme Technology: Developing purified engineered SCD enzymes for in vitro modification of lipids for food, cosmetic, or pharmaceutical applications.

    • Synthetic Biology Platforms: Incorporating engineered SCD variants into synthetic biology systems for production of novel fatty acids with industrial applications.

    • Biomaterials: Creating specialized lipids through engineered SCD activity for development of novel biomaterials, including liposomes for drug delivery.

  • Research Tool Applications:

    • Structure-Function Analysis: Using systematically engineered SCD variants to map critical residues for substrate binding, catalysis, and regulation.

    • Metabolic Pathway Engineering: Employing SCD variants as components in engineered metabolic pathways for studying fatty acid metabolism.

    • Reporter Systems: Developing SCD-based reporter systems for monitoring lipid metabolism in real-time in cellular models.

    • Comparative Biochemistry: Creating chimeric SCD proteins combining elements from different species to understand evolutionary adaptations in lipid metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.