Recombinant Goat ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

Recombinant Goat ATP synthase subunit a (MT-ATP6) is encoded by the mitochondrial MT-ATP6 gene and synthesized using recombinant DNA technology in Capra hircus (goat) systems. Key features include:

PropertyDetail
UniProt IDQ32644
Expression RegionAmino acids 1–226 (full-length protein)
Molecular Weight~25 kDa (predicted)
Storage Conditions-20°C in Tris-based buffer with 50% glycerol; avoid repeated freeze-thaw
SequenceIncludes conserved domains for proton channel formation and c-ring binding

The protein forms part of the Fo proton channel in ATP synthase, enabling coupling of proton flow to ATP synthesis . Its structure includes transmembrane helices critical for interactions with the c-ring and peripheral stalk components .

Production and Purification

The recombinant protein is generated via heterologous expression systems, often using synthetic peptides corresponding to residues 1–50 of human MT-ATP6 as immunogens . Key steps include:

  • Cloning: The MT-ATP6 gene is inserted into expression vectors optimized for eukaryotic systems .

  • Purification: Affinity chromatography tags (e.g., His-tag) facilitate isolation, ensuring >90% purity for immunoassays .

  • Quality Control: Validated via SDS-PAGE, Western blot, and ELISA to confirm reactivity and specificity .

Antibody Development

Recombinant goat MT-ATP6 is widely used to generate polyclonal antibodies (e.g., ab190287 from Abcam), which target its C-terminal region . These antibodies are validated for:

  • Western blotting

  • Immunohistochemistry

  • Mitochondrial complex V activity assays

Disease Studies

Pathogenic MT-ATP6 mutations (e.g., m.8993T>G) impair ATP synthesis and are linked to neurodegenerative disorders like Leigh syndrome and NARP . Recombinant proteins enable:

  • Functional studies of mutant ATP synthase

  • Biochemical assays measuring proton gradient coupling efficiency

Biochemical and Functional Insights

Studies using recombinant MT-ATP6 have revealed:

  • Proton Channel Dynamics: Subunit a coordinates with the c-ring to regulate proton flow, with mutations disrupting membrane potential .

  • Pathogenic Mechanisms: Variants like m.9185T>C reduce ATP hydrolysis rates and destabilize Complex V assembly .

  • Therapeutic Targets: Drugs targeting subunit a could modulate mitochondrial energy output in metabolic diseases .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Capra hircus (Goat)
Target Names
Target Protein Sequence
MNENLFTSFITPMMLGLPLVTLIILFPSLLFPSSNRLINNRLVSLQQWALQLMSKQMMSI HNTKGQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFRNK TKASLAHFYPQGTPTPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLA LTSISPTTALITFIILILLTILEFELGTREAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for producing ATP from ADP in the presence of a proton gradient across the membrane. This gradient is generated by electron transport complexes within the respiratory chain. F-type ATPases comprise two structural domains: F(1), encompassing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. The ATP synthase subunit a is a key component of the proton channel and may directly participate in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its function in cellular metabolism?

MT-ATP6 (mitochondrially encoded ATP synthase membrane subunit 6) encodes the ATP synthase subunit a, which is an essential component of the F-type ATP synthase (Complex V) in the mitochondrial electron transport chain. This protein plays a critical role in oxidative phosphorylation by facilitating proton translocation across the inner mitochondrial membrane. Specifically, MT-ATP6 forms part of the F₀ complex, the transmembrane portion of ATP synthase that creates a channel allowing protons to flow across the membrane. This proton gradient drives the conformational changes in the F₁ catalytic domain that converts ADP to ATP, producing the cellular energy currency . The protein is crucial for normal mitochondrial function and energy production in all tissues, particularly in those with high energy demands such as muscle, heart, and neural tissue .

How does goat MT-ATP6 differ structurally and functionally from human MT-ATP6?

While both goat and human MT-ATP6 serve the same fundamental function in ATP production, species-specific variations exist in the amino acid sequence. The human MT-ATP6 protein weighs approximately 24.8 kDa and consists of 226 amino acids . Recombinant goat MT-ATP6 preserves the core functional domains essential for proton channel formation and interaction with other ATP synthase subunits. Conservation analysis of MT-ATP6 across mammals shows high sequence homology in functionally critical regions, particularly in the transmembrane domains and in residues that directly participate in proton translocation. These conserved regions are essential targets when designing antibodies or experimental interventions that might work across species barriers .

What are the common applications of recombinant goat MT-ATP6 in research settings?

Recombinant goat MT-ATP6 serves multiple research purposes, including:

  • As a positive control in Western blot analyses when studying mitochondrial function or energy metabolism

  • As an immunogen for antibody production against MT-ATP6

  • In structural biology studies investigating the assembly and function of ATP synthase

  • As a tool to study species-specific variations in mitochondrial energy production

  • In cell-based assays measuring oxidative phosphorylation efficiency

  • For investigating protein-protein interactions within the ATP synthase complex

For Western blot applications specifically, recombinant goat MT-ATP6 antibodies have shown reactivity with human samples due to conserved epitopes in the C-terminal region, making them valuable tools for comparative studies across species .

What expression systems are most effective for producing recombinant goat MT-ATP6?

The most effective expression systems for producing functional recombinant goat MT-ATP6 are those that can properly handle membrane proteins with complex folding requirements. Bacterial expression systems (particularly modified E. coli strains) can be used for producing segments of the protein for antibody generation, but often struggle with full-length, properly folded MT-ATP6. For research requiring functional protein, mammalian expression systems (such as HEK293 or CHO cells) provide superior post-translational modifications and proper protein folding. Insect cell systems (Sf9 or Hi5) represent an effective middle ground, offering better folding than bacterial systems while being more economical than mammalian systems. When expressing recombinant MT-ATP6, inclusion of a purification tag (His, FLAG, or GST) is recommended, placed at the C-terminus to minimize interference with the protein's native structure and function .

What are the optimal conditions for Western blot detection of recombinant goat MT-ATP6?

For optimal Western blot detection of recombinant goat MT-ATP6, researchers should consider the following protocol parameters:

  • Sample preparation: Use mitochondrial extraction protocols that preserve membrane protein integrity

  • Gel percentage: 12-15% SDS-PAGE gels provide optimal resolution for the ~25 kDa MT-ATP6 protein

  • Transfer conditions: Semi-dry transfer at 15V for 30 minutes or wet transfer at 30V overnight at 4°C

  • Blocking: 5% non-fat dry milk in TBST for 1 hour at room temperature

  • Primary antibody: Anti-MT-ATP6 antibody at 0.1-1 μg/ml concentration in blocking buffer

  • Incubation: Overnight at 4°C with gentle agitation

  • Detection system: HRP-conjugated secondary antibody with enhanced chemiluminescence

When using goat polyclonal MT-ATP6 antibodies for detection, it's crucial to use appropriate secondary antibodies that won't cross-react with the goat immunoglobulins in your experimental system. For recombinant goat MT-ATP6 detection in Western blots, antibodies targeting the C-terminal region (amino acids 1-50) have demonstrated high specificity and sensitivity .

How can researchers effectively isolate mitochondria to study native versus recombinant MT-ATP6 interactions?

Effective isolation of intact, functional mitochondria is critical for studying MT-ATP6 in its native environment versus introducing recombinant protein. A recommended differential centrifugation protocol includes:

  • Tissue homogenization in isotonic buffer (250 mM sucrose, 10 mM Tris-HCl, 1 mM EDTA, pH 7.4)

  • Low-speed centrifugation (1,000 × g for 10 minutes) to remove nuclei and cell debris

  • Medium-speed centrifugation of the supernatant (10,000 × g for 10 minutes) to pellet mitochondria

  • Washing the mitochondrial pellet twice in isolation buffer

  • Resuspension in appropriate buffer for downstream applications

For more purified preparations, density gradient centrifugation using Percoll or sucrose gradients can further separate mitochondrial subpopulations. Once isolated, mitochondria can be used for functional assays, protein extraction, or reconstitution experiments with recombinant MT-ATP6. To study the integration of recombinant MT-ATP6 into native ATP synthase complexes, researchers can employ blue native PAGE to visualize intact complexes, followed by second-dimension SDS-PAGE to separate individual subunits .

What fluorescent imaging techniques are most suitable for tracking recombinant MT-ATP6 localization and dynamics?

Several fluorescent imaging techniques are particularly valuable for studying recombinant MT-ATP6 localization and dynamics:

  • Confocal microscopy with fluorescently tagged MT-ATP6: Using GFP or other fluorescent protein fusions to track real-time localization within cells.

  • Super-resolution microscopy: Techniques such as STED, PALM, or STORM provide nanoscale resolution (20-50 nm) to differentiate between mitochondrial inner membrane localization and potential transport to other cellular compartments.

  • FRET (Förster Resonance Energy Transfer): For studying protein-protein interactions between MT-ATP6 and other ATP synthase components.

  • Photoactivatable fluorescent proteins: Systems using paGFP-tagged ATP5B have successfully visualized ATP synthase transport from mitochondria to the plasma membrane .

  • TIRF (Total Internal Reflection Fluorescence) microscopy: Particularly useful for studying potential surface expression of MT-ATP6, as observed in some cell types .

When designing these experiments, it's important to verify that fluorescent tags don't interfere with MT-ATP6 folding, assembly into the ATP synthase complex, or interaction with other mitochondrial components. C-terminal tagging is generally preferred as it minimizes disruption to mitochondrial import sequences .

How does recombinant MT-ATP6 integrate into existing ATP synthase complexes when introduced to cells?

Integration of recombinant MT-ATP6 into existing ATP synthase complexes involves a complex process influenced by mitochondrial import machinery and assembly factors. Research indicates that MT-ATP6, despite being mitochondrially encoded in nature, can be experimentally introduced as a nuclear-encoded recombinant protein with appropriate targeting sequences.

The integration process follows several stages:

  • Import into mitochondria via the TOM/TIM protein import pathways

  • Insertion into the inner mitochondrial membrane

  • Assembly with other F₀ subunits

  • Integration into the complete F₁F₀ ATP synthase complex

Successful integration can be assessed using blue native PAGE coupled with activity staining or in-gel activity assays to confirm functional incorporation. ATP synthase activity measurements (ATP production rates) provide functional verification of proper integration. Researchers should note that assembly efficiency varies significantly depending on the expression system, targeting sequences used, and the presence of specific assembly factors. Time-course experiments tracking labeled recombinant MT-ATP6 show that complete integration into functional complexes typically requires 24-48 hours following transfection .

What are the critical differences in using recombinant MT-ATP6 versus native protein for structure-function studies?

When conducting structure-function studies, several critical differences exist between recombinant and native MT-ATP6:

ParameterNative MT-ATP6Recombinant MT-ATP6
SourceMitochondrially translatedNuclear-encoded and imported
Post-translational modificationsComplete and authenticMay lack specific modifications
Assembly contextAssembled co-translationallyPost-import assembly
Structural conformationNative folding in membranePotential folding variations
Interactions with other subunitsComplete interaction networkMay miss transient interactions
Functional analysisReflects physiological activityMay show altered kinetics

How does the ectopic expression of MT-ATP6 on cell surfaces relate to its primary mitochondrial function?

Recent research has identified the unexpected presence of ATP synthase components, including MT-ATP6, on the plasma membrane of certain cell types. This ectopic ATP synthase appears to be assembled in mitochondria and subsequently transported to the cell surface via microtubule-dependent mechanisms and dynamin-related protein 1 . This finding presents intriguing questions about additional functions of MT-ATP6 beyond its canonical role in mitochondrial ATP production.

The plasma membrane-localized ATP synthase containing MT-ATP6 may serve several functions:

  • Contributing to extracellular ATP generation

  • Sensing cellular energy status

  • Participating in cell-cell communication

  • Potentially mediating interactions with extracellular proteins

Experiments tracking tagged ATP synthase components have visualized the transport process, showing that entire mitochondrial segments containing both outer and inner membranes can fuse with the plasma membrane. This process involves microtubule-dependent transport systems and appears to be regulated in response to cellular energy demands and stress conditions. The functional significance of this ectopic expression remains an active area of research, with implications for understanding cellular energy homeostasis in both normal physiology and disease states .

What methodologies are most effective for studying the proton channel function of recombinant MT-ATP6?

Studying the proton channel function of recombinant MT-ATP6 requires specialized techniques that can detect proton translocation across membranes. The most effective methodologies include:

  • Liposome reconstitution assays: Purified recombinant MT-ATP6 is incorporated into liposomes loaded with pH-sensitive fluorescent dyes (such as ACMA or pyranine) to monitor proton flux.

  • Patch-clamp electrophysiology: When reconstituted into planar lipid bilayers or expressed in cells, this technique can directly measure the electrical properties of the proton channel.

  • Proton-motive force measurements: Using potentiometric dyes like TMRM to assess membrane potential changes associated with proton translocation.

  • Deuterium exchange mass spectrometry: For identifying specific residues involved in the proton translocation pathway by measuring hydrogen-deuterium exchange rates.

  • Site-directed mutagenesis coupled with functional assays: Systematic mutation of conserved residues suspected to be involved in proton translocation, followed by activity measurements.

When conducting these experiments, it's crucial to maintain appropriate membrane environments and pH gradients that mimic physiological conditions. Comparative studies with known proton channel inhibitors (such as oligomycin) can validate the specificity of observed effects .

What are common pitfalls when working with recombinant goat MT-ATP6 and how can they be avoided?

Researchers frequently encounter several challenges when working with recombinant goat MT-ATP6:

  • Poor expression yields: As a hydrophobic membrane protein, MT-ATP6 often expresses at low levels. Optimize by using specialized expression systems for membrane proteins, lower induction temperatures (16-18°C), and membrane-mimetic environments during purification.

  • Protein aggregation: MT-ATP6 may aggregate during purification. Include appropriate detergents (DDM, LMNG, or Triton X-100) throughout the purification process and avoid freeze-thaw cycles.

  • Loss of function: Recombinant MT-ATP6 may not properly fold or integrate into functional complexes. Validate function with ATP synthesis assays or proton translocation measurements after reconstitution.

  • Non-specific antibody binding: Polyclonal antibodies may cross-react with other proteins. Carefully validate antibody specificity using knockout/knockdown controls and pre-absorption with the immunizing peptide.

  • Inefficient mitochondrial targeting: When expressing nuclear-encoded recombinant MT-ATP6, inefficient mitochondrial targeting may occur. Use optimized mitochondrial targeting sequences and confirm localization with fractionation studies.

To minimize these issues, researchers should perform pilot studies with small-scale expression tests, optimize buffer conditions for each experimental step, and include appropriate positive and negative controls for functional assays .

How can researchers differentiate between effects of recombinant MT-ATP6 and endogenous protein in experimental systems?

Differentiating between recombinant and endogenous MT-ATP6 effects requires careful experimental design:

  • Epitope tagging: Add unique tags (His, FLAG, HA) to recombinant MT-ATP6 that allow specific detection without cross-reactivity with endogenous protein.

  • Species-specific antibodies: When introducing goat recombinant MT-ATP6 into non-goat cell lines, use species-specific antibodies that differentiate between the recombinant and endogenous proteins.

  • Silent mutations for RNA detection: Introduce silent mutations in the recombinant cDNA that allow specific detection of recombinant transcripts by RT-PCR or RNA-seq without altering protein sequence.

  • CRISPR/Cas9 knockout systems: Create cell lines with endogenous MT-ATP6 function disrupted (though complete knockout is challenging for this essential gene) before introducing recombinant protein.

  • Inducible expression systems: Use tetracycline-inducible or similar systems to control recombinant expression temporally, allowing before/after comparisons in the same cells.

For data analysis, complementary approaches should be used to confirm findings, such as combining imaging, biochemical assays, and functional measurements. Quantitative analysis comparing expression levels between recombinant and endogenous protein is essential for meaningful interpretation of results .

What contradictions exist in the current literature regarding MT-ATP6 function and how should researchers address these in experimental design?

Several contradictions and knowledge gaps exist in the current MT-ATP6 literature that researchers should consider:

  • Dual localization contradiction: While traditionally considered exclusively mitochondrial, recent evidence suggests ATP synthase components including MT-ATP6 can localize to the plasma membrane . Experimental designs should include multiple localization techniques and controls for antibody specificity.

  • Assembly pathway disparities: Different models exist for ATP synthase assembly and the precise timing of MT-ATP6 incorporation. When studying assembly, researchers should utilize time-course experiments and multiple detection methods.

  • Functional significance of mutations: The same MT-ATP6 mutations can produce varying disease phenotypes in different patients. Researchers should consider genetic background effects and design experiments that include multiple cell types or model systems.

  • Proton pathway structural model discrepancies: Different structural models propose varying amino acids as critical for proton translocation. Address this by combining structural studies with functional assays and evolutionary conservation analysis.

  • Ectopic function debates: The function of ectopically expressed ATP synthase remains controversial. Design experiments that can clearly distinguish surface activity from mitochondrial activity, perhaps using non-permeable inhibitors or surface-specific labeling techniques.

To address these contradictions, researchers should implement multi-method approaches, carefully document experimental conditions, use appropriate controls, and critically evaluate methodological differences when comparing their results to published literature .

What emerging technologies hold promise for advancing recombinant MT-ATP6 research?

Several cutting-edge technologies are poised to significantly advance MT-ATP6 research:

  • Cryo-electron microscopy: Continuing improvements in resolution allow more detailed structural analysis of MT-ATP6 within the ATP synthase complex, potentially revealing conformational changes during the catalytic cycle.

  • Genome editing with CRISPR/Cas9: Enables precise modification of MT-ATP6 in cellular and animal models to study function and disease relevance.

  • Single-molecule techniques: Methods such as single-molecule FRET and optical tweezers can directly observe conformational changes and energy transduction in individual ATP synthase complexes.

  • Quantitative proteomics: Mass spectrometry approaches with improved sensitivity allow better characterization of MT-ATP6 interactions and post-translational modifications.

  • Organoid and microphysiological systems: These advanced cell culture models better recapitulate tissue-specific energy demands and mitochondrial function.

  • Artificial intelligence for protein structure prediction: Tools like AlphaFold provide new opportunities to model MT-ATP6 structure and interactions, especially for species where experimental structures are unavailable.

These technologies will help resolve existing questions about MT-ATP6 function while opening new avenues for investigation, particularly regarding tissue-specific functions and potential non-canonical roles .

How can recombinant MT-ATP6 research contribute to understanding mitochondrial disease mechanisms?

Recombinant MT-ATP6 research offers several pathways to better understand mitochondrial disease mechanisms:

  • Structure-function analysis of disease mutations: Introducing disease-associated mutations into recombinant MT-ATP6 allows detailed analysis of their effects on protein folding, assembly, and function without the confounding effects of heteroplasmy encountered in patient samples.

  • Drug screening platforms: Stable cell lines expressing mutant recombinant MT-ATP6 provide platforms for screening therapeutic compounds that might restore function or stabilize the ATP synthase complex.

  • Precision medicine approaches: Comparing the biochemical consequences of different mutations can help explain clinical heterogeneity and guide personalized treatment approaches.

  • Gene therapy development: Research with recombinant MT-ATP6 can inform strategies for gene replacement or editing approaches in mitochondrial disorders.

  • Biomarker identification: Studies of cells expressing mutant MT-ATP6 may reveal secondary metabolic changes that could serve as diagnostic or prognostic biomarkers.

Mutations in MT-ATP6 are associated with several mitochondrial disorders, most notably Leigh syndrome, found in approximately 10-20% of affected individuals. The most common MT-ATP6 mutation, T8993G, impairs ATP synthase function and oxidative phosphorylation, ultimately leading to energy deficiency and cell death, particularly affecting tissues with high energy demands .

What are the key experimental considerations when investigating tissue-specific effects of recombinant MT-ATP6?

Investigating tissue-specific effects of recombinant MT-ATP6 requires careful experimental design:

  • Selection of appropriate cell models: Different tissues have varying energy demands and mitochondrial characteristics. Select cell types that represent tissues of interest (neurons for neurological effects, myocytes for muscle effects) or use tissue-specific differentiated iPSCs.

  • Tissue-specific expression systems: Use promoters that recapitulate tissue-specific expression patterns when introducing recombinant MT-ATP6.

  • Consideration of mitochondrial heterogeneity: Mitochondria differ in morphology, membrane potential, and function across tissues. Include analyses of mitochondrial networks and dynamics alongside functional studies.

  • Integration with tissue-specific interactomes: MT-ATP6 may interact with different proteins in different tissues. Perform tissue-specific interactome analyses to identify context-dependent binding partners.

  • Metabolic context: Different tissues utilize different metabolic pathways. Measure tissue-relevant metabolic parameters beyond ATP production (e.g., lactate production, oxygen consumption, specific substrate utilization).

  • In vivo validation: Whenever possible, validate findings from cell culture in appropriate animal models with tissue-specific expression or knockout of MT-ATP6.

When interpreting results, researchers should consider that observed differences might reflect varying mitochondrial content, energy demands, or compensatory mechanisms rather than intrinsic differences in MT-ATP6 function across tissues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.