Recombinant Goat Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please inform us of any specific tag requirements for preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Capra hircus (Goat)
Target Names
Target Protein Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETVWTILPAIILIMIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLFYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Uniprot No.

Target Background

Function
Goat Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (in subunit 2) and heme a (in subunit 1) to the active site (in subunit 1), a binuclear center (BNC) comprised of heme a3 and CuB. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what is its fundamental role in mitochondrial function?

MT-CO2 (Cytochrome c oxidase subunit II) is one of the core catalytic subunits of mitochondrial Cytochrome c oxidase (CcO), also known as respiratory chain complex IV. This protein contains a dual core CuA active site that plays a critical role in the electron transport chain and cellular respiration . MT-CO2 functions as an essential component in the terminal complex of the electron transport chain, facilitating the transfer of electrons from cytochrome c to molecular oxygen.

Methodologically, researchers studying MT-CO2 function typically employ spectrophotometric assays to measure its catalytic activity. These assays monitor the oxidation of reduced cytochrome c, which can be quantified by measuring the decrease in absorbance at 550 nm. In experimental settings, recombinant MT-CO2 has demonstrated the ability to catalyze the oxidation of cytochrome c substrate, confirming its functional role in electron transfer .

The protein contains a binuclear CuA site that accepts electrons from cytochrome c in the intermembrane space. These electrons are subsequently transferred through the complex to the oxygen reduction site (CuB-heme a3 center) in the COX1 subunit, where molecular oxygen is reduced to water . This process is coupled to proton pumping across the inner mitochondrial membrane, contributing to the electrochemical gradient necessary for ATP synthesis.

What are the structural characteristics of goat MT-CO2 and how does it compare to other species?

While the search results don't specifically detail goat MT-CO2, comparative structural analysis can be inferred from studies of other mammalian MT-CO2 proteins. Based on research with other species, MT-CO2 typically contains a transmembrane domain and a hydrophilic domain that protrudes into the intermembrane space of mitochondria. The hydrophilic domain houses the functionally critical CuA center consisting of two copper atoms .

For structural characterization, researchers typically employ techniques such as:

  • Sequence analysis and structural prediction: In studies of insect COXII, researchers have identified an open reading frame (ORF) of 684 bp encoding 227 amino acid residues, with a predicted molecular mass of 26.2 kDa and pI value of 6.37 . Similar analyses would be applied to goat MT-CO2.

  • Multiple sequence alignment and phylogenetic analysis: These approaches reveal evolutionary relationships and conserved functional domains. Such analyses have shown high sequence identity between COXII proteins across different insect species , and similar approaches would be valuable for comparing goat MT-CO2 with other mammalian homologs.

  • X-ray crystallography and cryo-EM: These techniques provide atomic-resolution structures of the protein, revealing the precise arrangement of the CuA center and interactions with neighboring subunits.

When comparing across species, researchers focus on conserved functional domains, particularly the copper-binding motifs essential for electron transfer. The CuA site in MT-CO2 typically includes conserved cysteine and histidine residues that coordinate the copper atoms, forming a unique binuclear center with mixed-valence properties .

What expression systems are most effective for producing recombinant goat MT-CO2?

For recombinant expression of MT-CO2, researchers have successfully employed bacterial expression systems, particularly E. coli. The methodology typically involves:

  • Vector selection: Vectors such as pET-32a have been used successfully for COXII expression . This vector includes a 6-His tag that facilitates downstream purification.

  • Host strain optimization: E. coli Transetta (DE3) has been documented as an effective expression system for COXII . This strain is engineered to enhance the expression of eukaryotic proteins that contain codons rarely used in E. coli.

  • Induction conditions: Isopropyl β-d-thiogalactopyranoside (IPTG) is commonly used to induce protein expression in bacterial systems. The concentration and timing of IPTG addition can significantly impact protein yield and quality .

What purification strategies yield high-purity recombinant MT-CO2?

Purification of recombinant MT-CO2 typically employs a multi-step approach to achieve high purity while maintaining protein functionality:

  • Affinity chromatography: His-tagged recombinant MT-CO2 can be purified using Ni²⁺-NTA agarose columns. This method has been shown to effectively isolate recombinant COXII proteins . The elution is typically performed using increasing concentrations of imidazole.

  • Size exclusion chromatography: This technique separates proteins based on molecular size and is useful for removing aggregates and contaminants of different molecular weights.

  • Ion exchange chromatography: Given that the predicted pI value of COXII in some species is around 6.37 , cation or anion exchange chromatography can be employed depending on the buffer pH.

  • Western blotting validation: Western blotting using anti-His antibodies or MT-CO2-specific antibodies confirms the identity and integrity of the purified protein. Previous studies have shown recombinant COXII with a 6-His tag to be approximately 44 kD by Western blotting .

The final protein concentration achieved through these methods can reach approximately 50 μg/mL , though yields may vary depending on expression conditions and specific purification protocols.

How does MT-CO2 contribute to metabolic reprogramming during cellular stress?

Recent research has revealed a previously unrecognized role for MT-CO2 in metabolic adaptation during cellular stress, particularly under glucose-deprived conditions. This represents an advanced area of investigation with significant implications for understanding cellular resilience mechanisms.

Glucose deprivation has been shown to upregulate MT-CO2 expression, suggesting a role beyond its classical function in the electron transport chain . Mechanistically, this upregulation occurs through:

  • Enhanced transcriptional activation: Glucose deprivation activates Ras signaling pathways that increase MT-CO2 transcription .

  • Post-transcriptional regulation: Stabilization of MT-CO2 mRNA occurs through inhibition of RNA-binding proteins such as IGF2BP3 .

The elevated MT-CO2 levels subsequently facilitate metabolic reprogramming by:

  • Increasing FAD levels: MT-CO2 upregulation elevates flavin adenosine dinucleotide (FAD) concentrations .

  • Activating epigenetic modifiers: Increased FAD activates lysine-specific demethylase 1 (LSD1), which epigenetically upregulates JUN transcription .

  • Promoting glutaminolysis: This cascade ultimately enhances glutaminase-1 (GLS1) expression, shifting cellular metabolism from glycolysis to glutaminolysis as an alternative energy source .

For researchers investigating this phenomenon, methodological approaches include:

  • Metabolic flux analysis using isotope-labeled glutamine to quantify glutaminolysis rates

  • Chromatin immunoprecipitation (ChIP) to assess LSD1 binding to the JUN promoter

  • RNA-seq and metabolomics to comprehensively map transcriptional and metabolic changes

This metabolic role of MT-CO2 appears particularly critical in cancer cells, where elevated expression correlates with poor prognosis in lung cancer patients . This suggests potential therapeutic implications for targeting MT-CO2 in cancers with activated Ras signaling.

What are the challenges in functional reconstitution of recombinant MT-CO2?

The functional reconstitution of recombinant MT-CO2 presents several significant challenges for researchers:

  • Maintaining proper copper incorporation: The CuA center in MT-CO2 requires precise incorporation of copper atoms to form the binuclear site essential for electron transfer. In cellular systems, this process is facilitated by metallochaperones and assembly factors . In vitro reconstitution requires careful copper supplementation and potentially the co-expression of relevant metallochaperones.

  • Coordination with other subunits: In vivo, MT-CO2 functions as part of a large multisubunit complex, interacting with other core subunits like COX1 and COX3 . Functional studies may require co-expression with these partner proteins to reconstitute physiologically relevant activity.

  • Membrane protein challenges: As MT-CO2 contains transmembrane domains, ensuring proper folding and stability in vitro is challenging. Detergent selection for membrane protein extraction and subsequent reconstitution into liposomes or nanodiscs are critical considerations.

  • Post-translational modifications: Potential post-translational modifications that might be essential for goat MT-CO2 function could be absent in bacterial expression systems.

To address these challenges, researchers have developed several methodological approaches:

  • Co-expression with assembly factors: Expression of MT-CO2 alongside relevant copper chaperones that facilitate proper copper insertion

  • Activity assays: Spectrophotometric assays measuring cytochrome c oxidation can confirm functional reconstitution

  • Biophysical characterization: UV-spectrophotometry and infrared spectrometry can be used to analyze the catalytic properties of recombinant MT-CO2

How can molecular docking and site-directed mutagenesis illuminate MT-CO2 structure-function relationships?

Molecular docking and site-directed mutagenesis represent powerful complementary approaches for investigating structure-function relationships in MT-CO2:

  • Molecular docking applications:

    • Identifying binding sites for substrates or inhibitors

    • Elucidating protein-protein interaction interfaces

    • Predicting the impact of mutations on protein function

Previous research has utilized molecular docking to investigate interactions between COXII and potential inhibitors. For example, studies revealed that allyl isothiocyanate (AITC) interacts with COXII, with a sulfur atom from AITC forming a 2.9 Å hydrogen bond with Leu-31 . This type of analysis provides valuable insights for structure-based drug design and understanding protein regulation.

  • Site-directed mutagenesis strategy:

    • Target selection: Key residues for mutagenesis include those involved in copper coordination, electron transfer, or substrate binding

    • Mutant design: Conservative substitutions (maintaining similar physiochemical properties) can reveal subtle functional requirements, while non-conservative changes can completely abolish function

    • Functional characterization: Comparing wild-type and mutant proteins through activity assays, spectroscopic methods, and thermostability analyses

Together, these approaches create an iterative research workflow:

  • Predict important residues through molecular docking and structural analysis

  • Generate targeted mutations in these residues

  • Characterize functional consequences of mutations

  • Refine structural models based on experimental results

This iterative process has been particularly valuable for understanding copper center biogenesis in CcO. Research has demonstrated that specific mutations in the copper-binding domains dramatically affect assembly and function of the holoenzyme .

What is the role of MT-CO2 in coordinating metal center biogenesis in cytochrome c oxidase?

MT-CO2 plays a crucial role in the complex process of metal center biogenesis within cytochrome c oxidase, participating in a highly coordinated assembly pathway:

  • Copper center assembly: The CuA site in MT-CO2 represents one of two critical copper centers in CcO (the other being the CuB site in COX1) . These copper sites must be properly assembled for functional enzyme activity.

  • Coordination with metallochaperones: Research has revealed that CcO copper chaperones form macromolecular assemblies and cooperate with twin CX9C proteins to facilitate copper transfer . This process ensures proper metal incorporation while preventing potentially cytotoxic effects of free copper ions.

  • Sequential assembly process: Copper transfer to CcO occurs in a specific sequence, with CuA and CuB sites assembled in a coordinated manner . This sequential process is critical for preventing the accumulation of dysfunctional intermediates.

The methodological approach to studying this process typically involves:

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation, yeast two-hybrid, or proximity labeling to identify interactions between MT-CO2 and relevant assembly factors

  • Time-course assembly analysis: Pulse-chase experiments to track the temporal sequence of copper incorporation

  • Genetic approaches: Knockdown or knockout studies of specific assembly factors to determine their impact on MT-CO2 metallation and function

For example, research has demonstrated that knockout of COX19, a factor involved in CcO assembly, results in severely reduced COX1 levels (25% of wild-type) and undetectable COX2, highlighting the interdependence of these assembly processes .

What analytical techniques provide the most comprehensive characterization of recombinant MT-CO2?

Comprehensive characterization of recombinant MT-CO2 requires multiple complementary analytical techniques:

  • Protein identity and purity assessment:

    • SDS-PAGE: Evaluates protein size and purity

    • Western blotting: Confirms protein identity using specific antibodies

    • Mass spectrometry: Provides precise molecular weight determination and can identify post-translational modifications

  • Structural characterization:

    • Circular dichroism (CD): Assesses secondary structure composition

    • Fourier-transform infrared spectroscopy: Analyzes protein secondary structure and has been used to study COXII interactions with compounds like AITC

    • X-ray crystallography/Cryo-EM: Provides atomic-resolution structural information, critical for understanding the precise arrangement of the CuA center

  • Functional analysis:

    • UV-spectrophotometric assays: Measures the catalytic activity of MT-CO2 in cytochrome c oxidation

    • Oxygen consumption measurements: Quantifies the rate of oxygen reduction

    • Electron paramagnetic resonance (EPR): Characterizes the electronic properties of the copper centers

  • Interaction studies:

    • Isothermal titration calorimetry (ITC): Determines binding affinities with substrates or inhibitors

    • Surface plasmon resonance (SPR): Measures real-time binding kinetics

    • Molecular docking: Predicts interaction sites and binding modes, as demonstrated in studies with AITC

The data from these techniques can be integrated to create a comprehensive profile of the recombinant protein's structural integrity and functional capacity. For example, previous research combined Western blotting (showing a recombinant COXII of approximately 44 kD) with UV-spectrophotometric and infrared spectrometer analysis to demonstrate that the recombinant protein could catalyze the oxidation of cytochrome c .

Comparative Structural Properties of MT-CO2 Across Species

SpeciesORF Length (bp)Amino Acid CountMolecular Weight (kDa)pI ValueKey Structural Features
Insect (S. zeamais)68422726.26.37CuA active site
Human----Binuclear CuA site, hydrophilic domain in IMS
Goat (predicted)--26-28*6.3-6.8*Conserved Cu-binding motifs*

*Note: Values for goat MT-CO2 are predictions based on homology with other mammalian species, as specific data was not available in the search results.

MT-CO2 Expression and Purification Parameters

Expression SystemVectorInduction MethodPurification MethodProtein YieldMolecular Weight (observed)
E. coli Transetta (DE3)pET-32aIPTGNi²⁺-NTA affinity chromatography50 μg/mL~44 kD (with His-tag)

MT-CO2 Function in Metabolic Reprogramming

Cellular ConditionMT-CO2 ExpressionMetabolic EffectMolecular MechanismDownstream TargetReference
Normal glucoseBaselineOxidative phosphorylationStandard ETC function-
Glucose deprivationUpregulatedShift to glutaminolysis↑ FAD → ↑ LSD1 activity → ↑ JUN expressionGlutaminase-1 (GLS1)
Oncogenic Ras activationRequiredEnhanced glutaminolysis-Tumor cell survival

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.