Recombinant Goat Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Protein Architecture

Goat MC1R shares structural homology with human and other mammalian MC1Rs, featuring:

  • Seven transmembrane α-helical domains (TM1-TM7) characteristic of GPCRs .

  • Extracellular N-terminus with an N-linked glycosylation site and intracellular C-terminus with a palmitoylation site .

  • DRY motif at the junction of TM3 for G protein coupling and signal transduction .

Functional Role in Melanogenesis

MC1R regulates melanin synthesis via:

  • Binding to α-melanocyte-stimulating hormone (α-MSH), triggering cAMP production and eumelanin (black/brown pigment) synthesis .

  • Antagonism by agouti signaling protein (ASIP), which reverts melanocytes to phaeomelanin (red/yellow pigment) production .

Key SNPs Identified in Goat MC1R

Studies in Nubian and other goat breeds reveal critical single nucleotide polymorphisms (SNPs):

SNP PositionBase ChangeAmino Acid ChangePhenotypic AssociationSource
712A/GTrp → CysBlack/brown coat color
1160C/TSilentWool color variation
219N/AN/AWool color variation
Q225XC → TPremature stop codonRed coat color
C267WC → TCys → TrpBlack coat color

Note: Silent mutations (e.g., SNP 219) may influence splicing or regulatory regions .

Nonsense Mutations and Coat Color

A Q225X nonsense mutation truncates the MC1R protein, leading to:

  • Loss of function and phaeomelanin dominance.

  • Red coat color in homozygous carriers (e.g., Derivata di Siria goats) .

Positive Selection in Goat MC1R

Phylogenetic analyses reveal codons under diversifying selection, likely driven by domestication pressures:

CodonSelection MethodSignificanceSource
59REL, IFEL, SLAC, FELβ > α (positive selection)
218RELNonsynonymous substitution
248RELAdaptive evolution
327REL, IFELDivergence in coat color
364SLACFunctional divergence

Codon 59 shows pervasive positive selection across mammalian lineages, highlighting its role in evolutionary adaptation .

Epistatic Interactions

MC1R’s phenotypic effects may depend on interactions with other coat color genes (e.g., ASIP, TYR), complicating direct genotype-phenotype correlations .

Coat Color Prediction

MC1R genotyping enables:

  • Breeding programs targeting desirable wool/fleece traits (e.g., black, brown, or white phenotypes) .

  • Disease risk assessment, as MC1R variants correlate with skin cancer susceptibility in humans .

Recombinant DNA Studies

Recombinant MC1R proteins are used to:

  • Model ligand binding (e.g., α-MSH, ASIP) and downstream signaling pathways .

  • Investigate dimerization, which is critical for receptor trafficking and function .

Unresolved Questions

  • Incomplete penetrance: Red coat color in Derivata di Siria goats does not fully align with MC1R genotypes .

  • Epistatic effects: Limited understanding of interactions between MC1R and other pigmentation genes .

Research Priorities

  1. Functional validation of SNPs (e.g., C267W) in vitro.

  2. Genome-wide association studies to identify modifier loci.

  3. CRISPR-based editing to test MC1R’s role in melanogenesis and disease.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; MSHR; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
Full length protein
Species
Capra hircus (Goat)
Target Names
Target Protein Sequence
MPALGSPRRLLGSLNCTPPATLPLTLAPNRTGPQCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYYFICCLAMSDLLVSVSNVLETAVMLLLEAGVLATRAAVVQQLDNVI DVLICSSMVSSLCFLGAIAVDRYISIFYALRYHSVVTLPRAWRIIAAIWVASILTSVLSI TYYNHTVVLLCLVGFFIAMLALMAVLYVHMLARACQHARGIARLQKRQRPIHQGFGLKGA ATLTILLGVFFLCWGPFFLHLSLIVLCPQHPTCGCIFKNFNLFLALIICNAIVDPLIYAF RSQELRKTLQEVLQCSW
Uniprot No.

Target Background

Function
This receptor binds to Melanocyte-stimulating hormone (MSH) variants (alpha, beta, and gamma) and Adrenocorticotropic hormone (ACTH). Its activity is mediated by G proteins, which activate adenylate cyclase. It regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by controlling cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the MC1R gene in goats?

The Melanocortin-1 Receptor (MC1R) gene in goats consists of a single exon with a coding region of 954 base pairs that encodes a protein of 317 amino acids . Like other species, goat MC1R is a seven-transmembrane G protein-coupled receptor located on the cell membrane of melanocytes . The protein has a molecular mass of approximately 34.65 kDa and an isoelectric point of 8.70, making it weakly alkaline . Multiple sequence alignment analyses have shown that goat MC1R shares high sequence homology with other mammalian species – 99% similarity with pig, 87% with cow, 86% with human, 85% with dog, 84% with sheep, 81% with mouse, and 77% with chicken MC1R genes . This remarkable conservation across species reflects the critical functional importance of this receptor.

How does MC1R function in the melanogenesis pathway in goats?

MC1R functions as a crucial regulator in the melanogenesis pathway by controlling the switch between eumelanin (black/brown pigment) and phaeomelanin (yellow/red pigment) production . When activated by α-melanocyte-stimulating hormone (α-MSH), MC1R signals through adenylyl cyclase to increase intracellular cAMP levels . This signaling cascade leads to the assembly of a multi-protein complex that promotes the conversion of DOPAquinone to eumelanin rather than phaeomelanin . The ratio of eumelanin to phaeomelanin ultimately determines coat color in goats, with higher eumelanin levels resulting in darker phenotypes . Additionally, MC1R signaling can be antagonized by Agouti protein, which competes with α-MSH for binding to MC1R and promotes phaeomelanin synthesis when bound . This antagonistic relationship creates a finely tuned system for regulating pigmentation across different body regions and developmental stages.

What are the key differences between goat MC1R and MC1R in other species?

While goat MC1R maintains high sequence conservation with other mammalian species, several structural and functional differences have been documented. The coding region of goat MC1R (954 bp) encodes a slightly different protein length compared to some other species . Species-specific variations exist in critical binding domains that may affect ligand interactions and signaling efficiency. Unlike in humans, where MC1R variants strongly predict red hair phenotypes , the relationship between MC1R variants and coat color in goats shows more complex patterns with breed-specific effects .

For example, the nonsense mutation Q225X found in Girgentana goats creates a truncated protein that may have altered functionality, yet produces a different phenotypic outcome than similar mutations in other species . The binding dynamics between goat MC1R and its ligands (α-MSH and Agouti protein) also show subtle differences in affinity and downstream signaling compared to other ruminants. These species-specific differences highlight the importance of studying MC1R in a species-appropriate context rather than simply extrapolating findings across evolutionary boundaries.

What MC1R polymorphisms have been identified in different goat breeds?

Multiple studies have identified several significant polymorphisms in the MC1R gene across different goat breeds. In Nubian goats, three SNPs have been identified at positions 219, 712, and 1160 in the gene sequence . The C/T mutation at position 219 is a silent mutation that does not alter the amino acid sequence, while the A/G mutation at position 712 causes an amino acid change from tryptophan to cysteine in black and brown goat samples . In Sicilian goat breeds, five SNPs have been identified in the coding region: one nonsense mutation (Q225X), three missense mutations (A81V, F250V, and C267W), and one silent mutation at codon 43 . These polymorphisms vary in frequency across breeds, suggesting different selective pressures or founder effects in distinct goat populations.

Table 1: Key MC1R Polymorphisms Identified in Different Goat Breeds

BreedPolymorphismPositionNucleotide ChangeAmino Acid ChangePhenotypic Association
NubianSNP 1219C/TNone (silent)Unknown
NubianSNP 2712A/GTrp→CysBlack/brown coat color
NubianSNP 31160Not specifiedNot specifiedUnknown
Sicilian (Girgentana)NonsenseQ225XNot specifiedTruncated proteinPresent in all Girgentana goats
SicilianMissense 1A81VNot specifiedAla→ValUnknown
SicilianMissense 2F250VNot specifiedPhe→ValUnknown
SicilianMissense 3C267WNot specifiedCys→TrpUnknown
SicilianSilentCodon 43Not specifiedNoneUnknown

How do specific MC1R variants correlate with coat color phenotypes in goats?

The relationship between MC1R variants and coat color in goats demonstrates complex genotype-phenotype correlations that vary by breed. In Nubian goats, the A/G mutation at position 712 that causes a tryptophan to cysteine substitution appears specifically in black and brown individuals, suggesting a role in eumelanin production . This mutation may enhance MC1R signaling efficiency or alter its interaction with melanogenic enzymes, promoting eumelanin synthesis over phaeomelanin.

In Sicilian breeds, the nonsense mutation Q225X creates a truncated MC1R protein that is present in all Girgentana goats, which typically have white coats with reddish spots on the face . This premature stop codon likely produces a non-functional receptor that cannot properly respond to α-MSH stimulation, shifting the balance toward phaeomelanin production in these animals. Interestingly, the same mutation was also identified in three Derivata di Siria animals, which have different coat color patterns, indicating that genetic background and epistatic interactions with other color genes influence the phenotypic expression of MC1R variants .

Unlike in humans, where specific MC1R variants strongly predict red hair with high penetrance , coat color determination in goats appears to involve more complex genetic interactions, including potential epistatic effects with Agouti signaling protein (ASIP) and other modifier genes. These breed-specific associations provide valuable insights for both basic pigmentation biology and potential applications in breed identification and preservation programs.

How can we classify MC1R variants in terms of their functional impact?

MC1R variants can be classified based on their predicted functional impact using multiple approaches. From a molecular perspective, variants can be categorized as:

  • Loss-of-function variants: These include nonsense mutations (like Q225X in Sicilian goats) that create truncated proteins, frameshift mutations that alter the reading frame, or missense mutations that severely disrupt protein structure or function . These typically result in receptors with reduced or absent signaling capacity.

  • Partial loss-of-function variants: These include missense mutations that moderately alter receptor function without completely abolishing it. In humans, these are often classified as "r" alleles, showing milder effects on pigmentation .

  • Gain-of-function variants: Though less common, some variants may enhance receptor activity, leading to increased eumelanin production.

  • Neutral variants: Silent mutations or conservative amino acid substitutions that don't significantly alter protein function.

Computational prediction tools such as SIFT (Sorting Intolerant From Tolerant) and PolyPhen (Polymorphism Phenotyping) can be used to classify variants based on cross-species conservation and predicted structural alterations . Variants can be classified as "tolerant" or "intolerant," with high-impact mutations typically falling into the latter category.

Functionally, variants can be classified based on experimental assays measuring:

  • Ligand binding affinity

  • cAMP signaling capacity

  • Cell surface expression

  • Protein stability

This multifaceted classification approach provides a comprehensive understanding of how different MC1R variants might affect pigmentation phenotypes in goats and other species.

What are the optimal methods for cloning and expressing recombinant goat MC1R?

Cloning and expressing recombinant goat MC1R requires careful methodological considerations to ensure proper protein folding and functionality. Based on successful approaches in the literature, the following protocol is recommended:

  • Primer Design and Gene Amplification: Design primers flanking the complete coding region (954 bp) of goat MC1R, including 5' and 3' untranslated regions if regulatory elements are of interest . Use high-fidelity DNA polymerase for PCR amplification from genomic DNA, as MC1R is intronless in mammals.

  • Vector Selection: For mammalian expression, vectors with strong promoters like pCMV or pcDNA3.1 are recommended. For insect cell expression, baculovirus vectors have proven effective for producing functional MC1R protein . Consider adding epitope tags (HA, Flag, etc.) to facilitate detection and purification, but ensure they do not interfere with receptor function.

  • Expression Systems:

    • Mammalian cells: HEK293 or CHO cells provide appropriate post-translational modifications and membrane trafficking for functional studies .

    • Insect cells: Sf9 or High Five cells with baculovirus systems yield higher protein quantities for structural studies .

    • Xenopus melanophores: Useful for functional bioassays due to their visible pigment dispersion response to MC1R activation .

  • Verification: Confirm successful expression through Western blotting, immunofluorescence microscopy, or flow cytometry using antibodies against the receptor or epitope tags .

  • Functional Validation: Assess receptor functionality through cAMP assays, as MC1R activates adenylyl cyclase upon stimulation with α-MSH . The Xenopus melanophore pigment dispersion assay provides a visual readout of receptor activation and has been successfully used for characterizing MC1R function .

This systematic approach ensures production of correctly folded, functional recombinant goat MC1R suitable for downstream applications including ligand binding studies, signaling assays, and structural analyses.

What approaches can be used to measure ligand binding to recombinant MC1R?

Several complementary approaches can be employed to accurately measure ligand binding to recombinant MC1R:

Each method has distinct advantages and limitations, and combining multiple approaches provides the most comprehensive characterization of ligand-receptor interactions. Selection of the optimal method depends on the specific research question, available resources, and properties of the ligand being studied.

What functional assays are most informative for characterizing recombinant MC1R activity?

Several functional assays provide valuable information for comprehensive characterization of recombinant MC1R activity:

  • cAMP Measurement Assays: Since MC1R signals primarily through Gs proteins to activate adenylyl cyclase, measuring intracellular cAMP levels is the gold standard for assessing receptor functionality . Options include:

    • ELISA-based cAMP detection kits

    • Luminescence-based reporter systems (e.g., GloSensor)

    • FRET-based sensors for real-time cAMP dynamics

    • Radioimmunoassay (RIA) for cAMP quantification

  • Xenopus Melanophore Assay: This bioassay utilizes frog melanophores' ability to rapidly disperse or aggregate melanin granules in response to MC1R activation . The visible color change provides a direct readout of receptor activation, making it particularly useful for screening agonists, antagonists, and inverse agonists. This system has been successfully used to characterize Agouti protein antagonism of α-MSH at MC1R .

  • ERK/MAPK Signaling Assays: Beyond cAMP, MC1R can activate additional signaling pathways including ERK/MAPK. Measuring phosphorylation of downstream targets provides insights into the breadth of receptor signaling capacity.

  • Calcium Mobilization Assays: Though MC1R is primarily Gs-coupled, some variants or ligands may trigger calcium signaling. Fluorescent calcium indicators (Fluo-4, Fura-2) can detect these responses.

  • Receptor Internalization Assays: Following activation, MC1R undergoes internalization. Measuring this process through flow cytometry or microscopy provides information on receptor desensitization dynamics.

  • Gene Expression Analysis: Measuring expression changes in downstream targets (e.g., MITF, tyrosinase) provides functional readouts closer to the physiological endpoints of receptor activation.

  • In Vitro Melanin Synthesis: For functional studies in melanocytes, measuring melanin content after receptor stimulation provides a direct readout of the physiological consequence of MC1R activation.

Table 2: Comparison of Functional Assays for Recombinant MC1R Characterization

Assay TypeAdvantagesLimitationsBest Applications
cAMP MeasurementDirect measurement of primary signaling pathway; quantitativeDoes not capture non-cAMP pathwaysPotency determination; dose-response studies
Xenopus MelanophoreVisual readout; physiologically relevant; medium throughputSpecies differences; specialized cell cultureAntagonist screening; mechanism studies
ERK/MAPK SignalingCaptures secondary signaling pathwaysMore downstream from receptor; influenced by other factorsBiased signaling studies
Calcium MobilizationReal-time kinetics; high throughput potentialMC1R not primarily coupled to calcium signalingAlternative signaling pathway detection
Receptor InternalizationMeasures receptor regulationTechnical complexity; requires specialized equipmentDesensitization studies; chronic ligand effects
Gene ExpressionClosest to physiological outcomeTime-consuming; influenced by many factorsConfirmatory studies; physiological relevance
Melanin SynthesisDirect measure of end biological functionSlow response; influenced by other pathwaysValidation in melanocyte models

How can recombinant MC1R be utilized for structural biology studies?

Structural biology studies of recombinant MC1R present significant opportunities for understanding receptor function at the molecular level, though they come with technical challenges inherent to membrane proteins. Several approaches can be employed:

  • Cryo-Electron Microscopy (Cryo-EM): This technique has revolutionized GPCR structural biology by enabling visualization of receptors without crystallization. For recombinant MC1R, expression in mammalian or insect cells followed by detergent solubilization and purification in stabilizing conditions is the first step. Nanodiscs or amphipols can be used to maintain the native membrane environment. Recent advances in single-particle cryo-EM have enabled structures of GPCRs at near-atomic resolution, allowing visualization of ligand binding pockets and conformational changes.

  • X-ray Crystallography: While challenging for GPCRs, this approach can provide high-resolution structures when successful. Techniques to enhance crystallization probability include:

    • Fusion of stabilizing proteins (e.g., T4 lysozyme, BRIL) into intracellular loops

    • Thermostabilizing mutations

    • Antibody fragment (Fab) co-crystallization

    • Lipidic cubic phase crystallization

  • NMR Spectroscopy: Solution NMR studies can provide dynamic information about receptor conformations and ligand interactions. Selective isotopic labeling of recombinant MC1R expressed in specialized systems can enhance signal detection for specific receptor regions.

  • Molecular Dynamics Simulations: Computational approaches using homology models based on related GPCRs can predict structural features and dynamic behaviors of MC1R. These predictions can guide experimental design and help interpret experimental data, particularly for understanding how identified SNPs in goat MC1R might affect receptor structure and function .

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify regions of conformational change upon ligand binding without requiring full structural determination, providing insights into receptor dynamics.

These approaches can reveal critical information about:

  • The structural basis for α-MSH and Agouti protein binding to MC1R

  • Conformational changes associated with receptor activation

  • How specific mutations identified in goat breeds alter receptor structure and function

  • Structure-based design of selective ligands for functional studies

Understanding MC1R structure at the molecular level will significantly advance our knowledge of pigmentation biology and potentially enable targeted interventions for related disorders.

How can CRISPR-Cas9 technology be applied to study MC1R function in goat cells?

CRISPR-Cas9 technology offers powerful approaches for investigating MC1R function in goat cells through precise genome editing. Several strategic applications include:

  • Knockout Studies: Complete deletion of MC1R in goat melanocytes or fibroblasts can establish definitively the receptor's role in pigmentation pathways. This approach can verify whether MC1R is absolutely required for eumelanin production or if compensatory mechanisms exist. Guide RNAs targeting critical regions of the MC1R gene, such as the transmembrane domains essential for structure or ligand binding sites, can be designed for efficient knockout.

  • Precise SNP Introduction: CRISPR base editing or prime editing can be used to introduce specific SNPs identified in different goat breeds, such as the A/G mutation at position 712 found in Nubian goats or the Q225X nonsense mutation in Girgentana goats . This allows direct assessment of how these variants affect receptor function in an isogenic background, eliminating confounding genetic factors.

  • Reporter Systems: CRISPR can facilitate knock-in of fluorescent reporters downstream of MC1R or its target genes, enabling real-time visualization of pathway activation in response to different stimuli or genetic modifications.

  • Regulatory Element Analysis: CRISPR interference (CRISPRi) or activation (CRISPRa) can target the MC1R promoter or potential enhancers to modulate expression levels without altering the coding sequence, helping to dissect the importance of receptor abundance versus structural variations.

  • Multiplexed Screening: Libraries of guide RNAs targeting different regions of MC1R or related genes can be used in high-throughput screens to identify functional domains and potential interaction partners.

For goat-specific applications, several technical considerations are important:

  • Optimization of transfection/nucleofection protocols for goat cells

  • Verification of guide RNA efficiency in goat genomic context

  • Development of appropriate culture conditions for primary goat melanocytes

  • Validation of editing outcomes through sequencing and functional assays

This approach allows direct testing of hypotheses generated from association studies, such as whether the tryptophan to cysteine substitution in Nubian goats directly affects α-MSH binding or downstream signaling efficiency, providing mechanistic insights beyond correlative observations.

What are the contradictions in current research on goat MC1R and how might they be resolved?

Current research on goat MC1R contains several notable contradictions and knowledge gaps that warrant further investigation:

  • Genotype-Phenotype Correlation Inconsistencies: The same MC1R variants sometimes associate with different coat colors across breeds. For example, the Q225X nonsense mutation appears in all Girgentana goats (typically white with reddish facial spots) but also in some Derivata di Siria animals with different coloration . This suggests either:

    • Epistatic interactions with other genes (such as ASIP or TYRP1) modify MC1R effects

    • Breed-specific genetic backgrounds influence phenotypic expression

    • Environmental factors or epigenetic modifications play significant roles

    Resolution Approach: Comprehensive genomic and transcriptomic profiling across multiple breeds, combined with functional studies of MC1R variants in isogenic cell backgrounds, would help distinguish receptor-intrinsic effects from genetic modifiers.

  • Functional Impact Ambiguity: The precise signaling consequences of identified SNPs remain largely theoretical. For instance, the tryptophan to cysteine substitution at position 712 in Nubian goats is associated with black/brown coloration , but the mechanism by which this substitution affects receptor function is unknown.

    Resolution Approach: Systematic functional characterization of recombinant MC1R variants using cAMP assays, ligand binding studies, and protein stability assessments would clarify how specific mutations alter receptor activity.

  • Evolutionary Conservation Paradox: Despite high sequence conservation across species (77-99% similarity) , MC1R variants appear to have species-specific effects on pigmentation. This raises questions about which receptor domains are truly functionally critical versus those that can tolerate variation.

    Resolution Approach: Comparative studies using chimeric receptors or targeted mutagenesis of conserved versus variable regions could identify truly critical functional domains.

  • Methodological Discrepancies: Studies employ different techniques for MC1R characterization, making direct comparisons difficult. Some rely on association studies without functional validation, while others focus on in vitro assays that may not reflect in vivo complexity.

    Resolution Approach: Establishing standardized protocols for both genetic association studies and functional characterization would enable more reliable cross-study comparisons.

  • Limited Integration with Other Pigmentation Genes: Most studies focus on MC1R in isolation, neglecting its interactions with other key pigmentation genes like ASIP, TYRP1, and TYR.

    Resolution Approach: Systems biology approaches combining multiple pigmentation pathway components would provide a more comprehensive understanding of coat color determination.

Addressing these contradictions requires multidisciplinary approaches combining genetics, molecular biology, biochemistry, and computational modeling to develop a unified understanding of how MC1R variants influence goat coat color across different genetic and environmental contexts.

How might recombinant MC1R studies in goats inform comparative evolutionary biology?

Recombinant MC1R studies in goats provide valuable insights into comparative evolutionary biology across several dimensions:

  • Evolutionary Conservation and Divergence: The high sequence similarity of MC1R across species (77-99%) makes it an excellent model for studying how evolutionary pressures maintain core receptor functionality while allowing adaptive variation. Goat MC1R studies can reveal which domains have remained conserved due to functional constraints versus those that have diverged to enable species-specific adaptations. Systematic mutagenesis of conserved residues in recombinant goat MC1R can determine whether functional consequences are consistent across species, illuminating evolutionary constraints on GPCR signaling mechanisms.

  • Molecular Basis of Convergent Evolution: Similar coat color patterns have evolved independently in different lineages. For example, some goat MC1R variants produce phenotypes resembling those in other ruminants despite different causative mutations . Comparing the molecular mechanisms by which different MC1R variants influence pigmentation across species can reveal whether evolution has found similar or different molecular solutions to achieve comparable phenotypic outcomes. This addresses fundamental questions about the predictability of molecular evolution.

  • Domestication Effects on Genetic Diversity: Domestic goats show remarkable coat color diversity compared to their wild ancestors, suggesting relaxed selection or intentional breeding for novel phenotypes. Analyzing the distribution and functional effects of MC1R variants across wild and domestic goat populations can reveal how domestication has shaped genetic diversity at this locus. This provides insights into the broader question of how human-mediated selection alters genetic architecture.

  • Co-evolution of Interacting Proteins: MC1R interacts with both agonists (α-MSH) and antagonists (Agouti protein) . Comparing the binding dynamics and signaling consequences across species can reveal co-evolutionary patterns between receptors and their ligands. Recombinant protein studies using cross-species combinations (e.g., goat MC1R with human α-MSH) can determine the extent of functional compatibility, providing insights into the pace and constraints of co-evolutionary processes.

  • Adaptive Significance of Pigmentation Variation: Different environmental conditions may favor different pigmentation patterns. Correlating the distribution of functional MC1R variants with ecological factors across goat populations can reveal signatures of adaptive evolution. For example, variants affecting UV protection or thermoregulation might show geographic distribution patterns correlated with latitude or altitude.

These comparative approaches not only enhance our understanding of pigmentation biology but also contribute to fundamental evolutionary questions about molecular adaptation, constraints, and convergence across diverse mammalian lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.