Recombinant Goat Platelet-activating factor receptor (PTAFR)

Shipped with Ice Packs
In Stock

Description

Expression Systems

Recombinant goat PTAFR is typically produced in E. coli due to cost efficiency and scalability, though mammalian systems (e.g., transgenic goats) are alternatives for complex post-translational modifications .

Research Applications

  • Antibody Development: Used as an immunogen to generate anti-PTAFR antibodies for Western blotting, ELISA, and immunohistochemistry .

  • Mechanistic Studies: Enables structural analysis of ligand-binding domains and G-protein coupling motifs .

Challenges and Future Directions

  • Structural Limitations: Partial-length constructs may lack critical transmembrane domains, limiting functional studies .

  • Species-Specific Data: Most functional data derive from human/murine PTAFR; goat-specific roles in immunity or reproduction remain unexplored .

  • Technical Optimization: Improved expression systems (e.g., mammalian cell lines) could enhance protein stability and post-translational fidelity .

Comparative Analysis with Orthologs

FeatureGoat PTAFRHuman PTAFR (P25105)Mouse PTAFR
Amino Acid LengthPartial (UniProt Q9GK76) Full-length (342 aa) Full-length (341 aa)
Expression HostE. coli E. coli or mammalian cells E. coli
Key Functional MotifsUndetermined(D/N)P(X)2,3Y (critical for internalization) β-arrestin interaction domains

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
PTAFR; PAFR; Platelet-activating factor receptor; PAF-R; PAFr
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Capra hircus (Goat)
Target Names
Target Protein Sequence
MEPNNSFRVDSEFRYTLFPIFYSIVFVLGVIANSYVLWVFARLYPSKKFNEIKIFMVNLT MADLLFLVTLPLWIVYYYNQGDWILPKFLCNLAGCFFFINTYCSVAFLAVITYNRFQAVT RPIKTAQATTRKRGFLLSLIIWVSIVGAASYFFVLDSTNSEPKKTGSGNITRCFEHYEKG SIPVLIIHIFLVFSFFLVFLIILFCNLVIIRTLLTQQVQMQRNAEVKRRALWMVCTVLAV FVICFVPHHLVQLPWTLAELGFQDTDFHQGINDAHQVTLCLLSTNCVLDPIIYCFLTKKF RKHLTEKLYSMRESRKCSRATSETGTEVVVQLKDAPIKSLKY
Uniprot No.

Target Background

Function
Platelet-activating factor receptor (PTAFR) is a receptor for platelet activating factor, a chemotactic phospholipid mediator known for its potent inflammatory, smooth-muscle contractile, and hypotensive activity. PTAFR is believed to mediate its effects through a G protein that activates a phosphatidylinositol-calcium second messenger system.
Database Links

UniGene: Chi.20217

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and reconstitution conditions for recombinant goat PTAFR?

For optimal research applications, recombinant goat PTAFR should be stored according to these guidelines:

  • Lyophilized form: Stable for 12 months at -20°C/-80°C

  • Liquid form: Stable for 6 months at -20°C/-80°C

  • Working aliquots: Store at 4°C for up to one week

For reconstitution:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Aliquot for long-term storage at -20°C/-80°C

Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

How does PTAFR expression vary across different tissues?

While goat-specific expression data is limited, studies in other species provide insights applicable to goat research. In chickens, PAFR is abundantly expressed across multiple tissues, with approximately twofold higher expression in bone marrow compared to other organs . Consistent expression levels are observed in monocytes/macrophages, including cell lines (HD11), bone marrow-derived macrophages (BMDM), and peripheral blood mononuclear cells (PBMC) .

Interestingly, during macrophage differentiation, bone marrow mononuclear cells initially show downregulation of PAFR expression (threefold reduction), which returns to expected levels as cells differentiate into macrophages . This expression pattern likely reflects evolutionary conservation across species, suggesting similar tissue distribution in goats.

What functional assays are most effective for studying recombinant goat PTAFR activity?

Based on research with PTAFR in other species, several functional assays are recommended:

  • Calcium Mobilization Assay: Measure intracellular calcium signals over time (typically 3-second intervals for 216 seconds) using fluorescent calcium-sensitive probes following PTAFR stimulation with PAF . This assay provides real-time data on receptor activation.

  • Receptor Internalization Assays: Evaluate PTAFR downregulation following agonist exposure using:

    • Immunofluorescence (IF) to visualize receptor localization

    • Western blot (WB) analysis to detect receptor degradation

    • Flow cytometry (FACS) to quantify changes in receptor expression levels

  • Functional Cellular Assays:

    • Phagocytosis assays using fluorescent zymosan beads

    • Reactive oxygen species (ROS) detection using fluorescent probes

    • Inflammatory mediator production (e.g., NO, cytokines)

These assays can be adapted for goat PTAFR with appropriate species-specific controls.

How can researchers effectively distinguish between coupling and internalization mechanisms of goat PTAFR?

Distinguishing between G-protein coupling and receptor internalization requires careful experimental design based on known PTAFR mechanisms. Research on human PAFR demonstrates that these processes can be independent , suggesting similar mechanisms may exist in goat PTAFR.

Recommended approach:

  • Mutagenesis studies: Target key residues in the C-terminal tail and conserved motifs such as (D/N)P(X)₂,₃Y

    • C-terminal truncation (analogous to Cys317→Stop in human PAFR) to evaluate importance of the cytoplasmic tail in endocytosis

    • Mutations in conserved aspartate and tyrosine residues (analogous to Asp289→Ala/Asn and Tyr293→Ala/Phe in human PAFR)

  • Inhibitor studies:

    • Use clathrin-coated pit blockers and concanavalin A to assess endocytic mechanisms

    • Test protein kinase C inhibitors/activators to evaluate their effect on internalization

  • Coupled vs. uncoupled signaling assays:

    • Monitor G-protein activation (e.g., cAMP/IP₃ production)

    • Independently track receptor localization and degradation

    • Compare results between wild-type and mutant receptors

These approaches allow researchers to determine whether coupling to G-proteins and receptor internalization represent independent or linked processes in goat PTAFR signaling.

What are the recommended protocols for validating recombinant goat PTAFR purity and activity?

For comprehensive validation of recombinant goat PTAFR:

Purity Assessment:

  • SDS-PAGE with Coomassie staining (target purity >85%)

  • Western blot with anti-PTAFR antibodies (confirm specificity with isotype controls)

  • Mass spectrometry for precise molecular weight determination

Activity Validation:

  • Ligand Binding Assays:

    • Radiolabeled or fluorescently-labeled PAF binding

    • Competition binding with known PAFR antagonists (e.g., PCA 4248, WEB 2086)

  • Functional Response:

    • Calcium mobilization assays following PAF stimulation

    • Inhibition of response with specific antagonists for confirmation of specificity

  • Receptor Downregulation:

    • Monitor receptor internalization following PAF exposure using immunofluorescence or flow cytometry

    • Confirm PAFR-specific effects using antagonists

A comprehensive validation approach combines both purity and functional analyses to ensure research-grade quality.

How does PTAFR contribute to inflammatory processes in goat models?

Based on research in other species, PTAFR likely plays similar roles in goat inflammatory processes:

  • Macrophage activation:

    • PTAFR activation enhances phagocytosis of particles (e.g., zymosan beads)

    • PAF stimulation promotes ROS release in macrophages

    • These inflammatory functions are PAFR-dependent and can be blocked by specific antagonists

  • Cytokine production regulation:

    • Studies show that PAFR blockade or PAF degradation (using PAF-AH) reduces LPS-induced inflammatory responses

    • This suggests that endogenous PAF production contributes to pro-inflammatory cytokine expression

  • Integration with other inflammatory pathways:

    • PTAFR likely interacts with other inflammatory mediator systems

    • PAF-PAFR signaling has been implicated in cardiovascular diseases and inflammatory conditions

Researchers investigating goat models should consider these inflammatory pathways when designing experiments to study PTAFR's role in disease processes.

What are common technical challenges when working with recombinant goat PTAFR and how can they be addressed?

Challenge 1: Protein Stability and Activity Loss

  • Problem: Recombinant PTAFR can lose activity during storage or handling

  • Solution:

    • Add glycerol (5-50%) to stabilize protein during storage

    • Avoid repeated freeze-thaw cycles

    • Store aliquots at -80°C for long-term storage

    • Use working aliquots at 4°C for up to one week

Challenge 2: Validation of Antibody Cross-Reactivity

  • Problem: Limited availability of goat-specific PTAFR antibodies

  • Solution:

    • Test antibodies predicted to cross-react with conserved regions

    • Validate specificity using appropriate isotype controls

    • Confirm functionality in multiple assays (IF, WB, FACS)

Challenge 3: Distinguishing Direct PTAFR Effects from Secondary Effects

  • Problem: Difficulty separating receptor-specific responses from downstream effects

  • Solution:

    • Use specific PAFR antagonists (e.g., PCA 4248, WEB 2086) as controls

    • Implement siRNA knockdown approaches to reduce receptor expression

    • Compare results with PAFR-deficient cell models

Challenge 4: Reproducibility in Functional Assays

  • Problem: Variability in calcium mobilization and other functional responses

  • Solution:

    • Standardize cell density and passage number

    • Control temperature and timing precisely during experiments

    • Use internal controls for normalization

    • Analyze area under the curve (AUC) rather than peak values for calcium responses

How can researchers effectively study PTAFR expression in goat tissue samples?

Recommended Methods for PTAFR Expression Analysis:

What are potential applications of goat PTAFR in studying inflammatory disease models?

Research with PTAFR in other species highlights several promising applications for goat PTAFR in inflammatory disease research:

  • Cardiovascular Disease Models:

    • PAF-PAFR signaling has been implicated in atherosclerotic cardiovascular diseases

    • Goat models could provide insights into inflammatory mechanisms in these conditions

    • PTAFR antagonists may represent therapeutic targets for cardiovascular inflammation

  • Inflammatory Disease Research:

    • PTAFR activation is linked to pro-inflammatory and prothrombotic pathways

    • Goat models may help elucidate species-specific inflammatory responses

    • Studies could investigate dietary interventions (polar lipids, polyphenols) that affect these pathways

  • Cancer Research Applications:

    • PTAFR expression is upregulated in certain tumor types

    • The FOXM1-PTAFR-PTAF axis has been identified as potentially tumorigenic

    • Goat PTAFR could be used to study conserved mechanisms of this pathway

  • Agricultural and Veterinary Applications:

    • Understanding PTAFR biology in goats has potential applications in improving livestock health

    • May provide insights into inflammatory conditions affecting dairy production

    • Could lead to targeted interventions for inflammatory diseases in goats

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.