Recombinant Gomphosus varius Cytochrome c oxidase subunit 1 (mt-co1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Gomphosus varius Cytochrome c Oxidase Subunit 1 (mt-co1)

Recombinant Gomphosus varius Cytochrome c oxidase subunit 1 (mt-co1) is a recombinant protein derived from the Bird wrasse (Gomphosus varius), also known as Gomphosus tricolor. This protein is a crucial component of the mitochondrial electron transport chain, playing a pivotal role in cellular respiration by facilitating the transfer of electrons from cytochrome c to oxygen, thereby producing ATP .

Key Features of Recombinant Gomphosus varius Cytochrome c Oxidase Subunit 1 (mt-co1)

  • Species: Gomphosus varius (Bird wrasse)

  • Protein Type: Recombinant Protein

  • Uniprot Number: P29646

  • Storage Conditions: Store at -20°C or -80°C; avoid repeated freezing and thawing .

Structure and Function

Cytochrome c oxidase subunit 1 (COI) is a mitochondrial gene that encodes a subunit of the cytochrome c oxidase enzyme. This enzyme is essential for the final step of oxidative phosphorylation in mitochondria, where oxygen is reduced to water, and protons are pumped across the mitochondrial inner membrane to generate ATP .

Amino Acid Sequence

The amino acid sequence of the recombinant Gomphosus varius COI is crucial for understanding its structure and function. The sequence includes key motifs that facilitate electron transfer and proton pumping:

Amino Acid PositionSequence
1-155FFGHPEVYILILPGFGMISHIVAYYSGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGSIKWETPLLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIVA

Gene Names and Synonyms

  • Recommended Name: Cytochrome c oxidase subunit 1

  • Alternative Names: Cytochrome c oxidase polypeptide I

  • Gene Names: mt-co1, coi, coxi, mtco1 .

Applications in Research

The mt-co1 gene is widely used in molecular biology for species identification and phylogenetic analysis. This is due to its high variability among species, which allows for the discrimination of closely related species across most animal phyla, except Cnidaria .

DNA Barcoding

DNA barcoding using the mt-co1 gene has become a standard method for identifying species. It involves sequencing a short, standardized fragment of the mt-co1 gene to create a unique identifier for each species. This approach has been successful in distinguishing between closely related species in various taxonomic groups .

Research Findings

Recent studies have highlighted the utility of mt-co1 in understanding evolutionary relationships and species diversity. For example, mt-co1 sequences have been used to study the phylogenetics of various fish species, including the Bird wrasse .

Phylogenetic Analysis

Phylogenetic analysis using mt-co1 sequences can reveal evolutionary relationships among different species. This is particularly useful in marine biology, where species identification can be challenging due to morphological similarities.

Table: Phylogenetic Utility of mt-co1

Speciesmt-co1 Utility
Gomphosus variusSpecies identification and phylogenetic analysis
Other Fish SpeciesDiscrimination of closely related species
Marine InvertebratesLess effective due to slow sequence evolution

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will then fulfill your specific needs.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type selection occurs during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
mt-co1; coi; coxi; mtco1; Cytochrome c oxidase subunit 1; Cytochrome c oxidase polypeptide I; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Gomphosus varius (Bird wrasse) (Gomphosus tricolor)
Target Names
Target Protein Sequence
FFGHPEVYILILPGFGMISHIVAYYSGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVG MDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGSIKWETPLLWALGFIFLFTVGGLTGI VLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIVA
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 1 (mt-co1) is a vital component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work in tandem to transfer electrons originating from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner membrane, which fuels transmembrane transport and the activity of ATP synthase. Cytochrome c oxidase plays a critical role in catalyzing the reduction of oxygen to water within the respiratory chain. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred sequentially through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1, ultimately reaching the active site in subunit 1. This active site, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)), utilizes the four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Protein Families
Heme-copper respiratory oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO1 and what is its specific role in Gomphosus varius?

MT-CO1, also known as mitochondrial-encoded cytochrome c oxidase subunit 1, is an integral component of the mitochondrial electron transport chain. In Gomphosus varius (bird wrasse), as in other species, it functions within complex IV on the mitochondrial inner membrane, transferring electrons to oxygen to produce water. This process is critical for ATP synthesis and cellular energy production. The MT-CO1 protein is encoded by the mitochondrial genome and represents one of the most conserved mitochondrial genes across species, making it valuable for both functional studies and phylogenetic analysis in marine organisms.

Why is MT-CO1 commonly used as a genetic marker for fish species identification?

MT-CO1 has become the standard genetic marker for DNA barcoding and species identification in fish taxonomic studies due to several key characteristics. The gene evolves at a rate that creates sufficient variation between species while maintaining conservation within species. This makes it ideal for distinguishing between closely related fish species, including members of the Labridae family to which Gomphosus varius belongs. Additionally, the mitochondrial location means multiple copies exist per cell, enhancing detection sensitivity from small or degraded samples. The gene also contains conserved regions that allow for the design of universal primers that work across diverse fish taxa, facilitating standardized approaches to species identification.

How does MT-CO1 sequence variation in Gomphosus varius compare to other Labridae family members?

Comparative analysis of MT-CO1 sequences across Labridae reveals that Gomphosus varius maintains distinctive sequence patterns that reflect its evolutionary history within this diverse family of reef fishes. While conserved functional domains show high similarity across family members, variable regions exist that allow for species discrimination. These variable regions accumulate synonymous substitutions (which don't change amino acid sequence) at a much higher rate than non-synonymous substitutions, reflecting the functional constraints on this essential protein. Phylogenetic analysis using MT-CO1 has helped resolve taxonomic relationships within Labridae, confirming Gomphosus varius' position and its relationship to other wrasses. The pattern of sequence divergence also provides insights into the tempo and mode of evolution within this lineage, indicating periods of rapid diversification followed by stabilizing selection.

What are the structural characteristics of the MT-CO1 protein in fish species like Gomphosus varius?

The MT-CO1 protein in Gomphosus varius, like other vertebrates, is a highly hydrophobic membrane protein with multiple transmembrane domains that anchor it within the mitochondrial inner membrane. The mature protein contains approximately 500 amino acids organized into 12 transmembrane helices arranged in three functionally distinct groups. The protein contains binding sites for heme groups (a and a3) and copper ions that facilitate electron transfer. These catalytic centers are highly conserved across species, while surface-exposed regions show more variation. The hydrophobic nature of MT-CO1 creates significant challenges for recombinant expression and purification, requiring specialized approaches to maintain native conformation and activity. The protein's structure is optimized for its dual functions of electron transfer and proton pumping, which are essential for ATP synthesis.

What approaches are most effective for cloning and expressing recombinant Gomphosus varius MT-CO1?

Successful cloning and expression of recombinant Gomphosus varius MT-CO1 requires specialized approaches due to its hydrophobic nature and mitochondrial origin. The most effective protocol involves:

  • RNA extraction from fresh Gomphosus varius tissue using RNAzol or TRIzol reagents

  • cDNA synthesis using oligo(dT) primers and reverse transcriptase

  • PCR amplification with primers designed from conserved regions of fish MT-CO1

  • Cloning into a vector system specialized for membrane proteins (e.g., pET derivatives with fusion tags)

  • Expression in specialized host systems:

    • Bacterial systems: C41(DE3) or C43(DE3) strains designed for membrane proteins

    • Yeast systems: Pichia pastoris for eukaryotic processing capability

    • Insect cell systems: Sf9 or High Five cells for complex eukaryotic proteins

For optimal expression, the native mitochondrial gene sequence must be optimized for the chosen expression system, and fusion tags (such as His6, GST, or MBP) can improve solubility and facilitate purification. Co-expression with molecular chaperones may enhance proper folding of this complex membrane protein.

How can researchers verify the functional activity of recombinant MT-CO1 protein?

Verifying the functional activity of recombinant MT-CO1 protein requires specialized assays that measure its electron transfer capabilities and incorporation into Complex IV. A comprehensive validation approach includes:

  • Spectroscopic analysis:

    • Reduced-minus-oxidized difference spectra to confirm heme incorporation

    • Measurement of characteristic absorption peaks at 445 nm and 605 nm

  • Electron transfer activity:

    • Cytochrome c oxidation assay measuring the decreased absorbance at 550 nm

    • Oxygen consumption measurements using Clark-type electrodes

    • Determination of kinetic parameters (Km, Vmax) at varied substrate concentrations

  • Structural validation:

    • Circular dichroism to assess secondary structure composition

    • Limited proteolysis to verify proper folding

    • Blue native PAGE to confirm multiprotein complex formation

  • Reconstitution experiments:

    • Incorporation into proteoliposomes to measure proton pumping

    • Membrane potential measurements using potential-sensitive dyes

    • ATP synthesis coupling efficiency assessment

These assays should be benchmarked against native mitochondrial preparations from Gomphosus varius or closely related species to ensure the recombinant protein maintains physiologically relevant activity.

What CRISPR-Cas9 approaches could be used to study MT-CO1 function in model fish systems as proxies for Gomphosus varius?

While direct genetic manipulation of Gomphosus varius presents significant challenges, CRISPR-Cas9 approaches in model fish systems can provide valuable insights into MT-CO1 function applicable to Gomphosus varius. An effective strategy includes:

  • Conditional knockout systems using the GeneSwap approach:

    • Create fish cell lines with floxed endogenous mt-co1 genes

    • Introduce Cre recombinase alongside wild-type or mutated versions of the gene

    • Study effects without intermediate mitochondrial DNA loss

  • Implementation in model fish species:

    • Zebrafish embryos for rapid development and transparent visualization

    • Medaka for marine fish biology relevance

    • Design guide RNAs targeting conserved regions of mt-co1

  • Phenotypic analysis techniques:

    • Respirometry to measure oxygen consumption

    • MitoTracker staining to assess mitochondrial membrane potential

    • Seahorse XF analysis for real-time measurement of mitochondrial function

    • Behavioral assays to detect swimming capacity changes

  • Validation approaches:

    • Complementation with Gomphosus varius MT-CO1 to verify functional conservation

    • Site-directed mutagenesis to recreate natural variants observed in Gomphosus varius

    • Expression of tagged versions for localization and interaction studies

This approach allows researchers to determine the functional significance of specific amino acid substitutions identified in natural populations of Gomphosus varius without requiring direct genetic manipulation of this non-model species.

How can interactions between TACO1 and mt-co1 mRNA be studied to understand species-specific translation regulation?

Understanding the interaction between TACO1 (Translational Activator of Cytochrome c Oxidase subunit I) and mt-co1 mRNA is crucial for elucidating species-specific translation regulation in Gomphosus varius. Based on research in other species, TACO1 specifically binds to mt-co1 mRNA and is required for its efficient translation. To study these interactions:

  • Protein-RNA interaction analysis:

    • RNA electrophoretic mobility shift assays using recombinant TACO1 and synthesized mt-co1 RNA

    • UV crosslinking followed by immunoprecipitation to map binding sites

    • Surface plasmon resonance to determine binding kinetics and affinity

    • Microscale thermophoresis for quantitative binding parameters

  • Translation efficiency measurements:

    • In vitro translation assays using mitochondrial lysates

    • Polysome profiling to assess ribosome association with mt-co1 mRNA

    • Pulse labeling with radiolabeled amino acids to measure synthesis rates

    • Luciferase reporter constructs containing mt-co1 regulatory elements

  • Structural studies:

    • X-ray crystallography of TACO1-RNA complexes

    • NMR spectroscopy for dynamic interaction analysis

    • Cryo-EM of ribosome-TACO1-mRNA complexes

  • Comparative analysis:

    • Create chimeric TACO1 proteins with domains from different species

    • Test cross-species compatibility of TACO1-mt-co1 interactions

    • Identify species-specific adaptations in binding regions

These approaches can reveal how translation regulation of mt-co1 has evolved specifically in Gomphosus varius and related wrasses, potentially uncovering adaptations related to their unique ecological niches.

What purification strategies optimize recovery of functional recombinant MT-CO1 from expression systems?

Purifying functional recombinant MT-CO1 from expression systems requires specialized approaches to maintain the native conformation of this hydrophobic membrane protein. The optimal purification strategy includes:

StepMethodBuffer CompositionCritical Parameters
1. Cell lysisFrench press or sonication50 mM Tris-HCl pH 7.5, 150 mM NaCl, protease inhibitorsGentle disruption to preserve membrane integrity
2. Membrane isolationDifferential centrifugationSame as lysis buffer100,000×g centrifugation for 1 hour
3. Membrane solubilizationDetergent extractionLysis buffer + 1% DDM or digitonin4°C incubation, gentle rotation for 2 hours
4. Affinity chromatographyNi-NTA, anti-tag antibody, or specific ligandsSolubilization buffer + 0.05% detergentLow imidazole wash, gradual elution
5. Size exclusionSuperdex 20025 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.02% detergentFlow rate <0.5 ml/min to preserve complexes
6. Functional reconstitutionProteoliposome formationPhospholipids in detergent-containing bufferControlled detergent removal via Bio-Beads

Throughout the purification, it's essential to:

  • Maintain 4°C temperature to prevent protein degradation

  • Include specific lipids (cardiolipin) that stabilize MT-CO1

  • Verify protein integrity at each step using activity assays

  • Avoid freeze-thaw cycles that disrupt membrane protein structure

The purified protein should be validated for proper folding using spectroscopic methods and functional assays measuring electron transfer activity. Recovery typically ranges from 0.1-0.5 mg of pure protein per liter of expression culture.

What techniques allow differentiation between genuine MT-CO1 recombination events and PCR artifacts in evolutionary studies?

Distinguishing between genuine MT-CO1 recombination events and PCR artifacts is critical for accurate evolutionary analysis of Gomphosus varius. Based on methodologies developed for mtDNA studies, researchers should implement:

  • Prevention strategies:

    • Use high-fidelity polymerases with 3'→5' proofreading activity

    • Implement separate pre-PCR workstations to prevent contamination

    • Purify mtDNA before PCR amplification to reduce nuclear pseudogene co-amplification

    • Perform long-range PCR to minimize chimera formation during amplification

  • Detection methods:

    • Clone PCR products and sequence multiple independent clones (minimum 20-30)

    • Compare results from independent PCR reactions using different polymerases

    • Use specialized software (RDP4, GENECONV, Bootscan) to identify recombination signatures

    • Apply statistical tests that distinguish recombination from sequence convergence

  • Validation approaches:

    • Design PCR primers that specifically span suspected recombination junctions

    • Perform quantitative PCR to determine the abundance of recombinant forms

    • Use next-generation sequencing for deep coverage of mtDNA populations

    • Apply single-molecule real-time sequencing to eliminate PCR bias

  • Controls and standards:

    • Include artificial mixtures of known MT-CO1 haplotypes as controls

    • Perform dilution series to identify template switching threshold concentrations

    • Use mismatch-specific primers that selectively amplify potential recombinants

Research has shown that genuine mtDNA recombination events are extremely rare (<1% frequency), so findings suggesting higher recombination rates should be carefully scrutinized using multiple independent methods to rule out PCR artifacts.

What bioinformatic approaches are most appropriate for analyzing MT-CO1 sequence data from Gomphosus varius population studies?

Comprehensive bioinformatic analysis of MT-CO1 sequence data from Gomphosus varius populations requires a multi-faceted approach that captures evolutionary patterns at different scales. The recommended workflow includes:

  • Data quality control and preprocessing:

    • FASTQC for raw sequence quality assessment

    • Trimmomatic or Cutadapt for adapter removal and quality trimming

    • FLASH or PEAR for paired-end read merging

    • BLAST verification against reference databases to confirm species identity

  • Sequence alignment and curation:

    • MAFFT or MUSCLE with G-INS-i algorithm for accurate alignment

    • Gblocks for removing poorly aligned regions

    • TranslatorX for codon-aware alignment guided by amino acid sequence

  • Genetic diversity and population structure analysis:

    • DnaSP or Arlequin for calculating nucleotide diversity (π), haplotype diversity (Hd)

    • AMOVA implementation in Arlequin for hierarchical population structure

    • STRUCTURE or BAPS for assignment of individuals to populations

    • PopART for haplotype network visualization

  • Phylogenetic analysis:

    • ModelTest-NG for selecting appropriate evolutionary models

    • IQ-TREE with ultrafast bootstrap for maximum likelihood tree construction

    • BEAST2 for Bayesian phylogenetic inference and divergence time estimation

    • FigTree or iTOL for phylogenetic tree visualization and annotation

  • Selection and demographic analysis:

    • PAML for detecting sites under positive selection

    • McDonald-Kreitman test for comparing polymorphism and divergence

    • Tajima's D, Fu's Fs for detecting demographic changes or selection

    • Mismatch distribution analysis for demographic expansion testing

This comprehensive approach allows researchers to detect fine-scale population structure, identify evolutionary significant units for conservation, and understand the historical processes shaping genetic diversity in Gomphosus varius across its range.

How can recombinant MT-CO1 be used to develop species-specific detection methods for environmental DNA studies?

Recombinant MT-CO1 protein from Gomphosus varius provides a powerful tool for developing highly specific environmental DNA (eDNA) detection methods. This application follows a systematic development pipeline:

  • Recombinant protein production and antibody development:

    • Express and purify Gomphosus varius MT-CO1 protein fragments

    • Generate polyclonal or monoclonal antibodies with high specificity

    • Validate antibody specificity against closely related Labridae species

    • Optimize antibody conditions for environmental sample detection

  • DNA-based detection system development:

    • Use recombinant MT-CO1 as positive control template for assay optimization

    • Design species-specific primers targeting unique regions of MT-CO1

    • Develop hydrolysis probe (TaqMan) qPCR assays with specialized probe chemistry

    • Establish limits of detection and quantification using standardized DNA

  • Field implementation protocol:

    • Standardize water sampling methods (volume, filtration approach, preservation)

    • Optimize DNA extraction from environmental matrices

    • Implement rigorous contamination controls

    • Establish multi-replicate sampling design

  • Validation metrics:

    • Laboratory sensitivity: detect 1-10 copies of target DNA per reaction

    • Specificity: no amplification from sympatric wrasse species

    • Field validation: agreement with visual survey methods

    • Seasonal reliability: consistent detection across temperature ranges

This approach enables non-invasive monitoring of Gomphosus varius populations and migration patterns, supporting conservation efforts and ecological research without disturbing natural habitats or capturing specimens.

What insights can MT-CO1 analysis provide about the adaptation of Gomphosus varius to climate change?

MT-CO1 sequence and expression analysis can provide significant insights into how Gomphosus varius adapts to changing ocean temperatures and other climate change effects:

  • Adaptive evolution signatures:

    • Identification of MT-CO1 variants under positive selection in warming environments

    • Comparison of nonsynonymous to synonymous substitution rates (dN/dS) across thermal gradients

    • Detection of parallel evolution in geographically distant but thermally similar habitats

    • Correlation of specific amino acid changes with functional domains affecting thermal stability

  • Functional consequences of variation:

    • Measurement of enzyme kinetics (Km, Vmax) of different MT-CO1 variants at various temperatures

    • Assessment of protein stability and unfolding temperatures using differential scanning fluorimetry

    • Oxygen consumption efficiency across temperature ranges for different haplotypes

    • Production of reactive oxygen species under thermal stress conditions

  • Gene expression responses:

    • Quantification of MT-CO1 transcript abundance under thermal acclimation regimes

    • Coordination between mitochondrial and nuclear-encoded complex IV components

    • Temporal dynamics of expression changes during acute and chronic thermal stress

    • Tissue-specific expression patterns reflecting metabolic demands

  • Population-level patterns:

    • Geographic distribution of thermally adaptive MT-CO1 haplotypes

    • Correlation with current temperature regimes and future climate projections

    • Identification of potential climate refugia harboring genetic diversity

    • Modeling population connectivity and gene flow patterns under changing conditions

These insights can inform conservation strategies by identifying populations with adaptive potential and guiding management decisions to preserve genetic diversity critical for species persistence under climate change scenarios.

How can researchers resolve contradictions between MT-CO1 data and morphological evidence in Gomphosus varius taxonomy?

Resolving contradictions between MT-CO1 genetic data and morphological evidence in Gomphosus varius taxonomy requires an integrative approach that acknowledges limitations of both data types:

  • Expanded genetic sampling strategy:

    • Increase geographic sampling across the species' entire range

    • Sequence multiple mitochondrial markers beyond MT-CO1 (cytb, ND2)

    • Include nuclear markers (RAG1, rhodopsin) to create multi-locus datasets

    • Implement genomic approaches (RAD-seq, whole-genome resequencing) for comprehensive genetic perspective

  • Enhanced morphological analysis:

    • Apply geometric morphometrics for quantitative shape analysis

    • Increase sample sizes to account for intraspecific variation

    • Document ontogenetic changes and sexual dimorphism

    • Include meristic counts, morphometric measurements, and coloration patterns

  • Integrative analytical frameworks:

    • Implement Bayesian species delimitation incorporating multiple data types

    • Use total evidence phylogenetic approaches

    • Apply machine learning algorithms to find patterns across datasets

    • Test explicit hypotheses about character evolution and biogeography

  • Investigating biological explanations for discordance:

    • Incomplete lineage sorting in recently diverged lineages

    • Mitochondrial introgression from historical hybridization

    • Sexual selection driving rapid morphological divergence

    • Local adaptation creating ecomorphs within genetic lineages

  • Decision framework for taxonomic resolution:

PatternPotential ExplanationMethods for ResolutionExample Studies
Morphological differences without MT-CO1 divergenceRecent divergence, selection on nuclear genesGenome-wide SNP analysis, QTL mappingColor morphs in other Labridae
MT-CO1 divergence without morphological differencesCryptic species, neutral evolutionAdditional genetic markers, breeding trialsCryptic species complexes in coral reef fishes
Geographic structuring in either datasetLocal adaptation, isolation by distanceLandscape/seascape genomics, common garden experimentsRegional adaptations in widespread marine species
Discordance between datasetsIntrogression, selection, driftCoalescent analysis, historical demographic modelingHybridization zones in other wrasses

This comprehensive approach ensures that taxonomic decisions are based on multiple lines of evidence, reducing the risk of erroneous classifications based on single marker studies or limited morphological sampling.

What are the primary challenges in ensuring proper folding and function of recombinant MT-CO1 from Gomphosus varius?

Ensuring proper folding and function of recombinant Gomphosus varius MT-CO1 presents several technical challenges that must be addressed through specialized approaches:

  • Membrane protein expression barriers:

    • Hydrophobic transmembrane domains often aggregate during expression

    • Requirement for specific lipid environment for stability

    • Potential toxicity to host cells during overexpression

    • Co-translational insertion into membranes necessary for proper folding

  • Species-specific cofactor requirements:

    • Need for proper heme incorporation during protein synthesis

    • Copper binding sites must be correctly formed

    • Requirement for specific chaperones that may be absent in heterologous systems

    • Post-translational modifications specific to fish mitochondria

  • Complex assembly considerations:

    • MT-CO1 naturally functions as part of multi-subunit Complex IV

    • Interaction surfaces with other complex components affect stability

    • Sequential assembly process may be disrupted in recombinant systems

    • Subunit stoichiometry difficult to maintain in isolation

  • Technical solutions:

    • Use of specialized expression systems:

      • Membrane-protein-optimized E. coli strains (C41/C43)

      • Cell-free systems with added microsomes

      • Fish cell lines for homologous expression

    • Modified expression constructs:

      • Fusion with solubility-enhancing tags (MBP, SUMO)

      • Strategic removal of highly hydrophobic regions

      • Codon optimization for chosen expression system

    • Optimized purification conditions:

      • Screening multiple detergents (DDM, digitonin, LMNG)

      • Addition of stabilizing lipids, especially cardiolipin

      • Inclusion of cofactors during purification

      • Rapid purification at low temperatures

The success rate for obtaining functionally active recombinant MT-CO1 is typically low (<10%), requiring extensive optimization and validation through activity assays specific to cytochrome c oxidase function.

How might single-cell and spatial omics techniques advance our understanding of MT-CO1 expression in Gomphosus varius tissues?

Emerging single-cell and spatial omics technologies offer transformative potential for understanding MT-CO1 expression and function in Gomphosus varius tissues with unprecedented resolution:

  • Single-cell transcriptomics applications:

    • Identification of cell type-specific MT-CO1 expression patterns

    • Discovery of correlation between MT-CO1 and nuclear-encoded ETC components

    • Capture of transcriptional responses to environmental stressors at cellular resolution

    • Detection of rare cell populations with distinctive mitochondrial expression profiles

  • Spatial transcriptomics approaches:

    • Mapping of MT-CO1 expression across tissue architecture

    • Correlation with metabolic zonation in organs like liver and muscle

    • Identification of expression hotspots in relation to vascular supply

    • Visualization of expression changes during developmental transitions

  • Single-cell proteomics capabilities:

    • Quantification of MT-CO1 protein abundance at single-cell level

    • Detection of post-translational modifications specific to cell types

    • Assessment of Complex IV assembly status across cell populations

    • Correlation between transcript and protein levels for mitochondrial genes

  • Multi-omics integration:

    • Combined RNA and protein measurements from the same cells

    • Correlation with functional parameters like membrane potential

    • Integration with metabolomic profiles

    • Computational modeling of cell-specific mitochondrial function

  • Technical considerations for application to Gomphosus varius:

    • Optimization of tissue dissociation protocols for marine fish tissues

    • Development of single-nucleus methods for challenging tissues

    • Cryopreservation approaches compatible with field sampling

    • Fish-specific antibody development for protein detection

    • Reference transcriptome construction for accurate quantification

These advanced techniques will reveal how MT-CO1 expression varies across diverse cell types in Gomphosus varius, providing insights into tissue-specific energetic requirements and responses to environmental change that cannot be captured by bulk tissue analysis.

What emerging technologies might overcome current limitations in studying mitochondrial gene function in non-model organisms like Gomphosus varius?

Several emerging technologies show promise for overcoming current limitations in studying mitochondrial gene function in non-model organisms like Gomphosus varius:

  • Mitochondrial genome editing approaches:

    • Mitochondria-targeted nucleases (mitoTALENs)

    • Base editors directed to mitochondria

    • RNA import systems for guide RNA delivery

    • Bacterial conjugation-based mtDNA transformation systems

  • Organoid and ex vivo culture systems:

    • Fish tissue-derived organoids maintaining native mitochondrial populations

    • Primary cell culture methods optimized for marine species

    • Organ-on-chip technologies mimicking tissue environments

    • Long-term culture systems for studying chronic adaptations

  • Non-invasive imaging technologies:

    • Genetically encoded mitochondrial reporters delivered by non-viral methods

    • Label-free imaging techniques sensitive to mitochondrial metabolites

    • Resonance Raman microscopy for cytochrome detection in vivo

    • Hyperspectral imaging for measuring mitochondrial functional parameters

  • Environmental genomics extensions:

    • Long-read sequencing of environmental DNA for complete mitochondrial genomes

    • Metatranscriptomics revealing expression in natural populations

    • Portable sequencing technologies enabling field-based genomics

    • Environmental metabolomics correlating mitochondrial function with habitat conditions

  • Computational and systems biology approaches:

    • Homology modeling and molecular dynamics simulations of MT-CO1 variants

    • Machine learning prediction of functional effects of sequence variations

    • Constraint-based metabolic modeling of species-specific mitochondrial function

    • Phylogenetically informed comparative analysis across fish lineages

The integration of these technologies will enable researchers to study mitochondrial gene function in non-model organisms without requiring traditional genetic manipulation, captive breeding programs, or established laboratory colonies, opening new avenues for understanding the unique adaptations of Gomphosus varius and similar species.

What are the most promising applications of recombinant MT-CO1 research for marine conservation?

Recombinant MT-CO1 research offers several promising applications for marine conservation, particularly for monitoring and protecting Gomphosus varius populations and their coral reef habitats:

  • Advanced monitoring technologies:

    • Species-specific eDNA detection kits using optimized primers and probes

    • Environmental protein detection using MT-CO1-specific antibodies

    • Portable sequencing platforms for field-based genetic monitoring

    • Automated image recognition systems trained on MT-CO1 genetic markers

  • Population health assessment tools:

    • Genetic diversity monitoring through targeted MT-CO1 sequencing

    • Detection of selective sweeps indicating environmental stressors

    • Identification of locally adapted variants for protection prioritization

    • Non-invasive health biomarkers based on eDNA fragment analysis

  • Climate adaptation research:

    • Identification of MT-CO1 variants associated with thermal tolerance

    • Mapping of adaptive genetic diversity across environmental gradients

    • Prediction of population-specific vulnerability to ocean warming

    • Design of protected area networks preserving adaptive potential

  • Practical conservation applications:

    • Monitoring effectiveness of marine protected areas using genetic connectivity

    • Tracking illegal fishing and wildlife trade through MT-CO1 barcoding

    • Designing assisted gene flow interventions to enhance resilience

    • Early detection of range shifts in response to climate change

These applications directly contribute to evidence-based conservation strategies for Gomphosus varius and the broader coral reef ecosystems they inhabit, generating data that can inform policy decisions and management actions.

How might integration of MT-CO1 data with other molecular markers improve our understanding of Gomphosus varius evolution?

Integration of MT-CO1 data with other molecular markers can provide a comprehensive understanding of Gomphosus varius evolution by addressing the limitations of single-marker approaches and revealing complex evolutionary processes:

  • Multi-marker mitochondrial approaches:

    • Sequencing complete mitochondrial genomes to detect selective sweeps

    • Analyzing protein-coding genes with different evolutionary rates

    • Assessing tRNA and rRNA genes for structural constraints

    • Examining non-coding regions for regulatory evolution

  • Nuclear-mitochondrial integration:

    • Comparison with nuclear genes to detect cytonuclear discordance

    • Assessment of nuclear-encoded mitochondrial proteins for co-evolution

    • Analysis of nuclear markers with different inheritance patterns

    • Detection of mitochondrial pseudogenes in nuclear genomes

  • Genome-wide approaches:

    • RAD-seq or whole-genome resequencing for population genomic analysis

    • Transcriptomics to correlate MT-CO1 expression with nuclear genes

    • Epigenetic analysis to detect environmental influence on expression

    • Metagenomics to understand host-microbiome interactions

  • Integrative analytical frameworks:

    • Coalescent-based species tree methods to resolve phylogenetic conflicts

    • Statistical tests for gene flow and introgression

    • Demographic reconstruction incorporating multiple marker types

    • Machine learning approaches for pattern detection across datasets

This integrated approach can uncover:

  • Historical hybridization events masked by mitochondrial data alone

  • Selective pressures acting differently on mitochondrial and nuclear genomes

  • Complex demographic histories including bottlenecks and expansions

  • Adaptive introgression contributing to local adaptation

The resulting evolutionary model provides a robust foundation for conservation genetics, taxonomy, and ecological research on Gomphosus varius and related wrasses.

What new research questions about MT-CO1 function in marine organisms are emerging from climate change research?

Climate change research is generating novel research questions about MT-CO1 function in marine organisms like Gomphosus varius, opening new avenues for understanding adaptation to rapidly changing ocean environments:

  • Thermal adaptation mechanisms:

    • How do specific amino acid substitutions in MT-CO1 affect protein stability at elevated temperatures?

    • What is the relationship between MT-CO1 sequence variants and critical thermal maxima?

    • How rapidly can selection act on standing variation in MT-CO1 during warming events?

    • Are there trade-offs between thermal optimization of MT-CO1 and its catalytic efficiency?

  • Oxygen availability responses:

    • How does MT-CO1 function respond to decreasing ocean oxygen levels?

    • Are there MT-CO1 variants that maintain efficiency under hypoxic conditions?

    • What is the relationship between MT-CO1 evolution and species' depth distribution?

    • How do oxygen binding kinetics differ among MT-CO1 variants from different habitats?

  • Ocean acidification effects:

    • How does reduced pH affect proton pumping function of MT-CO1?

    • Are there compensatory mechanisms maintaining MT-CO1 function under acidification?

    • Does acidification alter post-translational modifications of MT-CO1?

    • How does the interaction between warming and acidification affect MT-CO1 function?

  • Energetic trade-offs and life history:

    • How do MT-CO1 variants influence metabolic rates and energy allocation?

    • Is there a relationship between MT-CO1 efficiency and reproductive investment?

    • Do different life stages show different optimal MT-CO1 variants?

    • How does MT-CO1 function relate to species' dispersal capacity and range shifts?

Addressing these questions requires integrating molecular approaches with physiological measurements, ecological observations, and evolutionary analyses, creating a comprehensive understanding of how this key mitochondrial protein contributes to species' responses to climate change.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.