Recombinant Gorilla gorilla gorilla 5-hydroxytryptamine receptor 1B (HTR1B)

Shipped with Ice Packs
In Stock

Description

Functional Properties

HTR1B binds serotonin (5-HT) and regulates neurotransmitter release via Gαi/o protein signaling, inhibiting adenylate cyclase and modulating cAMP levels .

Functional Assays and Findings:

  • GTPγS Binding:

    • Serotonin induces robust GTPγS binding in HEK-293 cells, confirming G protein activation .

    • Methiothepin (antagonist) reduces basal GTPγS binding, indicating constitutive activity .

  • Ligand Selectivity:

    • Isochromans show higher affinity for primate 5-HT1D over 5-HT1B receptors, but mutations (e.g., T100I/R102H in guinea pigs) restore gorilla-like pharmacology .

    • Frovatriptan selectively targets 5-HT1B/1D subtypes, with 6,400-fold selectivity over 5-HT1A .

Migraine Pathophysiology

  • Non-human primate HTR1B receptors are critical models for studying anti-migraine drugs like triptans .

  • Gorilla HTR1B shares 99% sequence identity with humans, making it pharmacologically relevant .

Neurotransmitter Regulation

  • Modulates dopamine, serotonin, and acetylcholine release in the basal ganglia and hippocampus .

  • Linked to aggression, anxiety, and addiction in primate studies .

Drug Development

  • Used to test ligands like sumatriptan (EC₅₀ = 21–53 nM) and isochromans (e.g., PNU-109291) .

  • Constitutive activity observed in 5-HT1D receptors informs inverse agonist design .

Species-Specific Differences:

FeatureGorilla HTR1BGuinea Pig HTR1B
Isochroman AffinityHigh (Kd = 1.4 nM)Low (Kd = 5.7 nM)
GTPγS ResponseRobust (147 fmol/mg)Weak (36 fmol/mg)
Key ResiduesI100, H102 (TM2)T100, R102 (TM2)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. If you have specific format preferences, please indicate them in your order notes. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: Our standard shipping includes normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically maintains stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To ensure optimal stability, we recommend aliquoting for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please communicate your requirements to us, and we will prioritize development of the specified tag.
Synonyms
HTR1B; 5-hydroxytryptamine receptor 1B; 5-HT-1B; 5-HT1B; Serotonin receptor 1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
MEEPGAQCAPPXPAGSETWVPQANLSSAPSQNCSAKDYIYQDSIALPWKVLLVMLLALIT LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Uniprot No.

Target Background

Function
This G-protein coupled receptor recognizes 5-hydroxytryptamine (serotonin). Additionally, it serves as a receptor for various alkaloids and psychoactive substances. Ligand binding triggers a conformational change, initiating signaling through guanine nucleotide-binding proteins (G proteins) and modulating downstream effector activity, such as adenylate cyclase. Notably, this signaling process inhibits adenylate cyclase activity. Arrestin family members regulate signaling via G proteins and mediate the activation of alternative signaling pathways. The receptor plays a crucial role in regulating the release of 5-hydroxytryptamine, dopamine, and acetylcholine in the brain, influencing neural activity, nociceptive processing, pain perception, mood, and behavior. Furthermore, it contributes to vasoconstriction of cerebral arteries.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural similarity between gorilla HTR1B and human HTR1B?

Gorilla 5-HT1B receptor differs from the human receptor by only 1 amino acid residue, making it exceptionally similar in primary sequence to the human ortholog. This divergent residue is largely conservatively substituted and confined to either the N-terminal region or the third intracellular loop, away from transmembrane segments and intracellular loops near the membrane that are critical for ligand binding and G protein coupling . This high degree of conservation makes gorilla HTR1B an excellent model for human 5-HT1B receptor studies.

How can recombinant gorilla HTR1B be expressed in cellular systems?

Recombinant gorilla HTR1B can be heterologously expressed in human embryonic kidney 293 (HEK293) cells after cloning the receptor gene via polymerase chain reactions with genomic DNA and primers designed from corresponding human receptors . The methodology typically involves:

  • Isolation of gorilla genomic DNA

  • PCR amplification using primers based on human HTR1B sequences

  • Direct sequencing of PCR products to confirm identity

  • Cloning into an appropriate expression vector (such as pcDNA3.1+)

  • Transfection into HEK293 cells using standard methods

  • Validation of expression through functional assays

This expression system allows for robust receptor expression and subsequent pharmacological characterization .

What are the key structural motifs of gorilla HTR1B that are important for function?

Like other HTR1 family members across species, gorilla HTR1B contains several critical structural elements:

  • Seven hydrophobic transmembrane domains (TMD1-7)

  • A conserved 'DRY' motif at the C-terminal of the third transmembrane domain (TMD3) essential for receptor function

  • Two cysteine residues that form a disulfide bond critical for structural integrity

  • N-glycosylation sites at the N-terminus important for cell surface expression

These structural features are highly conserved across species and are crucial for proper receptor folding, ligand binding, and signal transduction mechanisms .

What signaling pathways are activated by gorilla HTR1B?

Gorilla HTR1B, when expressed in HEK293 cells, shows robust agonist-induced guanosine 5'γ[35S] triphosphate (GTPγ[35S]) binding through activation of G proteins containing Gαi subunits . The activation of the receptor leads to:

  • Inhibition of adenylate cyclase activity, resulting in decreased intracellular cAMP levels

  • Activation of the MAPK/ERK signaling cascade

  • Modulation of ion channel activity

The signaling profile is comparable to that of human HTR1B, validating gorilla HTR1B as a useful model for human receptor studies .

How does the pharmacological profile of gorilla HTR1B compare to human HTR1B?

The ligand binding and GTPγ[35S] binding profiles for gorilla HTR1B are comparable to those of human HTR1B, making it pharmacologically very similar . Both receptors show:

  • High affinity for serotonin (5-HT)

  • Similar response to selective agonists and antagonists

  • Comparable G-protein coupling efficiency

  • Similar constitutive activity patterns

This pharmacological similarity underscores the value of gorilla HTR1B as a model for human HTR1B in drug development and mechanistic studies .

How can functional activation of recombinant gorilla HTR1B be measured in experimental settings?

Several methodological approaches can be employed to measure functional activation of recombinant gorilla HTR1B:

  • GTPγ[35S] binding assays: Measures the exchange of GDP for GTP at G-protein α subunits upon receptor activation

  • cAMP inhibition assays: Using reporter systems like pGL3-CRE-luciferase to monitor the inhibition of adenylate cyclase activity

  • MAPK/ERK pathway activation: Using phospho-specific antibodies or pGL4-SRE-luciferase reporter systems

  • Calcium mobilization assays: Despite primarily coupling to Gαi, secondary coupling to calcium signaling can be monitored

  • β-arrestin recruitment assays: To assess receptor desensitization mechanisms

These functional assays provide complementary information about receptor activation, signaling, and regulation .

How does gorilla HTR1B compare to HTR1B receptors from other primate and non-primate species?

Comparative analysis reveals high conservation of HTR1B across species with varying degrees of similarity:

SpeciesAmino Acid Identity with Gorilla HTR1BKey Differences
Human~99% (1 residue difference)Minimal differences in N-terminal or 3rd intracellular loop
Chimpanzee~100% (0 residue difference)Virtually identical
Rhesus monkey~98% (7 residue differences)Differences mainly in N-terminal or 3rd intracellular loop
Mouse~86%More divergent sequences but conserved functional domains
Chicken~83%Significant differences while maintaining core functional elements
Xenopus tropicalis~81%Greater divergence in non-conserved regions

Despite sequence variations, the receptor maintains its core structural elements and functional properties across species, highlighting evolutionary conservation of this important serotonergic receptor .

What evolutionary insights can be gained from studying gorilla HTR1B?

The high conservation of HTR1B across primates suggests strong evolutionary pressure to maintain its structure and function. This conservation likely reflects the critical role of serotonergic signaling in fundamental neurological processes. Specific insights include:

  • The receptor's seven transmembrane domains show particularly high conservation, indicating their essential role in receptor function

  • The 'DRY' motif and other signaling elements are invariant across species, highlighting their critical functional importance

  • Most species differences occur in the N-terminal region and third intracellular loop, suggesting these regions may accommodate species-specific modulatory functions

  • The remarkable similarity between human and gorilla HTR1B (differing by only one residue) indicates minimal evolutionary divergence since the split between these lineages

These evolutionary insights help understand the fundamental importance of HTR1B in primate neurobiology and its potential role in species-specific behaviors .

What expression systems are optimal for producing functional recombinant gorilla HTR1B for research?

For optimal expression of functional recombinant gorilla HTR1B, several expression systems can be considered:

  • HEK293 cells: Most commonly used and demonstrated to produce functional gorilla HTR1B receptors with proper ligand binding and signaling properties

  • CHO cells: Provide a robust alternative with minimal endogenous receptor expression

  • Sf9 insect cells: Useful for large-scale production, especially for structural studies

  • Yeast expression systems: Can be employed for high-throughput screening

Each system offers advantages depending on the research goals:

  • HEK293 and CHO cells provide mammalian post-translational modifications and signaling machinery

  • Insect cells offer higher protein yields but with different glycosylation patterns

  • Yeast systems allow for cost-effective large-scale production

For most pharmacological and functional studies, HEK293 cells have been validated and are recommended as the primary expression system .

What are the key considerations for designing site-directed mutagenesis experiments with gorilla HTR1B?

When designing site-directed mutagenesis experiments for gorilla HTR1B, researchers should consider:

  • Target selection:

    • The one residue that differs from human HTR1B presents a natural target for understanding species differences

    • Highly conserved motifs like the 'DRY' sequence at the end of TMD3

    • Residues in transmembrane domains predicted to form the ligand-binding pocket

    • Residues at the cytoplasmic face involved in G-protein coupling

  • Methodology:

    • PCR-based site-directed mutagenesis using overlapping primers containing the desired mutation

    • Generation of chimeric receptors between gorilla and other species to identify domains responsible for specific properties

    • Alanine-scanning mutagenesis to identify functionally important residues

  • Functional validation:

    • Compare ligand binding profiles before and after mutation

    • Assess G-protein coupling using GTPγ[35S] binding assays

    • Measure downstream signaling using appropriate reporter systems

    • Evaluate receptor expression and localization

This approach has been successful in identifying species-specific pharmacological differences in related receptors, as demonstrated in studies comparing primate and rodent receptors .

How is gorilla HTR1B used as a model for understanding human neuropsychiatric disorders?

Gorilla HTR1B serves as an excellent model for human HTR1B due to their high sequence similarity (differing by only one residue) . This close relationship makes gorilla HTR1B valuable for studying neuropsychiatric disorders where the human receptor is implicated:

  • Migraine pathophysiology: Both 5-HT1B and 5-HT1D receptors are implicated in migraine, and gorilla models provide insights into therapeutic mechanisms

  • Substance use disorders: HTR1B plays a relevant role in substance-related conditions, and gorilla models help understand the underlying mechanisms

  • Obsessive-compulsive disorder (OCD): Evidence suggests HTR1B involvement in OCD, making gorilla models valuable for investigating this connection

  • Memory and motivation disorders: HTR1B is involved in neural networks for motivation and memory, functions that are impaired in many psychiatric conditions

The use of gorilla HTR1B validates non-human primates as useful models for human research in these areas, providing a closer approximation to human biology than rodent models .

What pharmacological tools can be used to study gorilla HTR1B function in experimental settings?

Several pharmacological tools are available for studying gorilla HTR1B function:

Compound ClassExamplesFunctionApplication
Non-selective agonists5-HT (serotonin)Natural ligandBaseline activation studies
Selective agonistsCP94253HTR1B-preferring agonistReceptor subtype selectivity
Selective antagonistsGR-127935HTR1B antagonistBlocking receptor function
Inverse agonistsMethiothepinReduces constitutive activityStudying basal activity
IsochromansVarious derivativesDifferential bindingSpecies comparison studies

These tools facilitate:

  • Characterization of gorilla HTR1B binding properties

  • Assessment of agonist-induced G-protein activation

  • Determination of constitutive receptor activity

  • Comparison with human HTR1B for translational research

  • Evaluation of novel compounds for therapeutic potential

The pharmacological profile of gorilla HTR1B is comparable to that of human HTR1B, making these tools valuable for translational research .

How can structural biology approaches be applied to study recombinant gorilla HTR1B?

Structural biology approaches offer powerful insights into gorilla HTR1B function and can be applied through:

  • Cryo-electron microscopy (Cryo-EM):

    • Allows visualization of receptor structure in native-like lipid environments

    • Can capture different conformational states (active, inactive, intermediate)

    • Enables study of receptor-G protein complexes

  • X-ray crystallography:

    • Provides high-resolution structures when crystals can be obtained

    • Typically requires receptor stabilization and modification

    • Useful for studying ligand-receptor complexes

  • Molecular dynamics simulations:

    • Leverages existing structural data to model receptor dynamics

    • Can predict conformational changes upon ligand binding

    • Helps identify potential allosteric binding sites

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Probes protein dynamics and ligand-induced conformational changes

    • Requires less protein than crystallography or cryo-EM

    • Provides complementary information to high-resolution structures

These approaches could reveal the structural basis for the high functional similarity between human and gorilla HTR1B despite the single amino acid difference, and potentially identify structural determinants of species-specific pharmacology .

What are the challenges and considerations in designing experiments to study the single amino acid difference between human and gorilla HTR1B?

Studying the functional impact of the single amino acid difference between human and gorilla HTR1B presents specific challenges that require careful experimental design:

  • Subtle phenotypic effects:

    • The single residue difference may produce subtle functional changes that require sensitive assays

    • Multiple complementary assays should be employed (binding, signaling, trafficking)

    • Quantitative rather than qualitative measurements are essential

  • Context dependency:

    • The functional impact may depend on the cellular environment

    • Different cell types should be tested to ensure robustness of findings

    • Native versus heterologous expression systems should be compared

  • Ligand specificity:

    • The difference might affect only certain ligands

    • A broad panel of structurally diverse ligands should be tested

    • Both agonists and antagonists should be evaluated

  • Technical approaches:

    • Reciprocal mutations (human→gorilla, gorilla→human)

    • Creation of chimeric receptors

    • Molecular dynamics simulations to predict functional effects

    • Detailed pharmacological profiling with multiple endpoints

This research is significant as it may reveal how minimal sequence variations can influence receptor function and provide insights into the evolutionary fine-tuning of serotonergic signaling in primates .

How can recombinant gorilla HTR1B be used in comparative studies with other serotonin receptor subtypes?

Recombinant gorilla HTR1B can be integrated into comparative studies with other serotonin receptor subtypes to develop a comprehensive understanding of serotonergic signaling:

  • Co-expression studies:

    • Express gorilla HTR1B alongside other 5-HT receptors (e.g., 5-HT1D, 5-HT1F)

    • Investigate receptor heterodimerization and functional interactions

    • Assess cross-talk between different serotonergic signaling pathways

  • Comparative pharmacology:

    • Create standardized assay platforms to compare pharmacological properties across receptor subtypes

    • Develop subtype selectivity profiles for novel compounds

    • Identify ligands with unique pharmacological fingerprints across subtypes

  • Signaling pathway analysis:

    • Compare G-protein coupling preferences between receptor subtypes

    • Assess differences in signal transduction pathways

    • Evaluate biased signaling properties across the receptor family

  • Evolutionary analysis:

    • Compare conservation patterns across different 5-HT receptor subtypes

    • Identify subtype-specific vs. family-conserved functional motifs

    • Reconstruct the evolutionary history of the 5-HT receptor family

These comparative approaches have proven valuable in understanding the functional diversity within the serotonin receptor family and can guide the development of subtype-selective therapeutic agents .

What is known about the role of gorilla HTR1B in migraine pathophysiology compared to human HTR1B?

Both gorilla and human HTR1B receptors are implicated in migraine pathophysiology, with current evidence suggesting largely similar roles:

  • Functional similarity:

    • Gorilla HTR1B differs from human HTR1B by only one amino acid residue

    • Ligand binding and G-protein coupling profiles are comparable between the species

    • Both receptors show similar responses to antimigraine medications

  • Vascular effects:

    • Both receptors mediate vasoconstriction of cerebral blood vessels

    • This effect is thought to counteract pathological vasodilation during migraine attacks

    • The high conservation suggests similar vascular regulatory functions

  • Neural modulation:

    • Both receptors likely modulate neurotransmitter release in trigeminal pathways

    • Their activation inhibits the release of pain-promoting neuropeptides

    • This function appears conserved between gorilla and human receptors

  • Pharmacological response:

    • Triptans and other 5-HT1B/1D agonists show similar binding to both receptors

    • The therapeutic effect profile is expected to be comparable

    • This validates gorilla HTR1B as a model for developing antimigraine drugs

The remarkable similarity between gorilla and human HTR1B validates non-human primates as useful models for human migraine research, offering closer approximation to human biology than rodent models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.