Recombinant Gorilla gorilla gorilla ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Structure and Production

Recombinant MT-ATP6 corresponds to the full-length mitochondrial protein (1-226 amino acids; UniProt ID: Q9T9Y7) encoded by the MT-ATP6 gene. Key production details include:

ParameterSpecification
Expression SystemEscherichia coli
TagN-terminal polyhistidine (His-tag)
Purity>85% (SDS-PAGE verified)
Catalog NumbersRFL4110GF (Creative BioMart), MBS7021438 (MyBioSource)

The protein forms part of the F0 subunit of ATP synthase, which facilitates proton translocation across mitochondrial membranes .

Functional Role in Mitochondrial Energy Production

MT-ATP6 is integral to ATP synthase (Complex V), which catalyzes the final step of oxidative phosphorylation:

  1. Proton Channel Formation: Enables proton flow across the inner mitochondrial membrane, generating a proton gradient .

  2. ATP Synthesis: Converts ADP to ATP using energy from proton flow .

Mutations in MT-ATP6 disrupt these processes, leading to mitochondrial disorders such as Leigh syndrome (10% of cases) . The T8993G mutation is particularly notable, altering proton channel function and reducing ATP synthesis .

Research Findings on Pathogenic Variants

Analysis of MT-ATP6 variants reveals diverse biochemical impacts:

VariantBiochemical AnomaliesClinical Correlation
m.8993T>G- Reduced ATP synthesis (36/38 cases)
- Abnormal holocomplex assembly (14/18)
Leigh syndrome, neuropathy
m.9185T>C- Decreased mitochondrial membrane potential (3/3)
- Impaired proton pumping
Developmental delays
m.9176T>C- Reduced ATP synthesis (6/7)
- Increased oxidative stress
Ataxia, muscle weakness

These variants impair ATP synthase stability or proton coupling efficiency, often elevating reactive oxygen species (ROS) and reducing cellular energy output .

Applications in Biomedical Research

  1. Disease Modeling: Study mitochondrial disorders like Leigh syndrome and neuropathy .

  2. Drug Development: Screen compounds targeting ATP synthase dysfunction .

  3. Structural Analysis: Investigate proton channel mechanics using recombinant MT-ATP6 .

Challenges and Future Directions

  • Heteroplasmy Variability: Symptom severity correlates with mutant mtDNA load, but thresholds vary widely (e.g., 70–90% for m.8993T>G) .

  • Biochemical Heterogeneity: No universal diagnostic marker exists; ATP synthesis rates, membrane potential, and oligomycin sensitivity must be assessed collectively .

Advances in cryo-EM and gene-editing technologies are expected to refine pathogenicity assessments of MT-ATP6 variants .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have any specific requirements for the format, please specify them in your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
MNENLFASFIAPTILGLPAAVLIILLPPLLIPTSKYLINNRLIATQQWLIQLTSKQMMTM HNAKGRTWSLMLMWLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGAVTTGFRSK TKNALAHLLPQGTPTPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLMHLIGSATLA MSTTNLPSTLIIFTVLILLTMLEIAVALIQAYVFTLLVSLYLHENT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane, which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. As a key component of the proton channel, subunit a may play a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its role in cellular energy production?

MT-ATP6 (ATP synthase subunit a) is a critical component of the mitochondrial ATP synthase complex (Complex V), specifically part of the F0 domain that forms the proton channel within the inner mitochondrial membrane. This subunit plays an essential role in the proton-motive force that drives ATP synthesis.

The ATP synthase complex functions as a molecular rotary motor, with the F0 component (containing MT-ATP6) serving as an electric rotary motor inside the mitochondrial matrix with ion pump functionality to transfer protons across the membrane. Meanwhile, the F1 component functions as a chemical rotary motor inside the inner mitochondrial membrane that catalyzes ATP production as its final product . This enzyme is responsible for more than 90% of cellular energy production in living organisms, making it central to bioenergetics research .

How does Gorilla gorilla gorilla MT-ATP6 compare structurally with human MT-ATP6?

While the search results don't provide a direct comparison between gorilla and human MT-ATP6, comparative analysis is important for researchers. Due to the close evolutionary relationship between gorillas and humans (both being hominids), their MT-ATP6 sequences share high homology. Researchers should note that even small differences in highly conserved proteins may provide valuable insights into evolutionary adaptations of mitochondrial energy production systems.

When conducting comparative studies, researchers should perform sequence alignments using bioinformatics tools like BLAST or Clustal Omega, focusing on:

  • Conserved functional domains

  • Species-specific amino acid substitutions

  • Structural implications of any sequence variations

  • Potential consequences for protein-protein interactions within the ATP synthase complex

What are the optimal conditions for expressing recombinant Gorilla gorilla gorilla MT-ATP6 in E. coli?

Based on the search results, recombinant Gorilla gorilla gorilla MT-ATP6 has been successfully expressed in E. coli . For optimal expression, researchers should consider:

  • Expression vector selection: Vectors containing strong promoters (T7, tac) with appropriate selection markers.

  • E. coli strain optimization: BL21(DE3) or derivatives are commonly used for membrane protein expression.

  • Induction parameters:

    • IPTG concentration: Typically 0.1-1.0 mM

    • Induction temperature: Lower temperatures (16-25°C) often yield better folding for membrane proteins

    • Induction duration: 4-16 hours depending on temperature

  • Media composition: Enriched media (2xYT, TB) often improve yields for challenging membrane proteins.

  • Codon optimization: Consider optimizing the gorilla sequence for E. coli codon usage to improve expression efficiency.

For membrane proteins like MT-ATP6, expression can be challenging due to potential toxicity and improper folding. Researchers may need to explore fusion partners that enhance solubility or directed-evolution approaches to optimize expression.

What purification strategy is recommended for His-tagged recombinant Gorilla gorilla gorilla MT-ATP6?

The search results indicate that recombinant Gorilla gorilla gorilla MT-ATP6 has been produced with an N-terminal His-tag . A recommended purification protocol would include:

  • Cell lysis: Use appropriate methods considering the membrane-bound nature of MT-ATP6:

    • Mechanical disruption (sonication, French press)

    • Enzymatic lysis with lysozyme

    • Inclusion of detergents to solubilize membrane fractions

  • Immobilized metal affinity chromatography (IMAC):

    • Ni-NTA or TALON resin

    • Buffer composition: Tris-based buffer with optimized pH (typically 7.5-8.0)

    • Detergent inclusion (e.g., n-dodecyl-β-D-maltoside or other mild detergents)

    • Imidazole gradient elution (20-250 mM)

  • Secondary purification:

    • Size exclusion chromatography to separate monomers from aggregates

    • Ion exchange chromatography for further purification if needed

  • Storage conditions:

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Aliquot and store at -20°C/-80°C

    • Consider adding 50% glycerol for long-term storage

  • Quality control:

    • SDS-PAGE (expecting >90% purity)

    • Western blot confirmation

    • Mass spectrometry verification

How should researchers reconstitute lyophilized recombinant Gorilla gorilla gorilla MT-ATP6?

Based on the product information from search result , the recommended reconstitution protocol is:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is the default recommendation)

  • Aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

Researchers should note that working aliquots can be stored at 4°C for up to one week . When planning experiments, schedule accordingly to minimize freeze-thaw cycles that could compromise protein integrity.

How can researchers effectively incorporate recombinant Gorilla gorilla gorilla MT-ATP6 into functional ATP synthase studies?

Researchers interested in studying functional aspects of ATP synthase using recombinant Gorilla gorilla gorilla MT-ATP6 can employ several methodological approaches:

  • Reconstitution into liposomes or nanodiscs:

    • Create artificial membrane systems using purified phospholipids

    • Incorporate purified MT-ATP6 using detergent-mediated reconstitution

    • Verify correct orientation using antibody accessibility assays

  • Assembly with other ATP synthase components:

    • Co-express with other subunits or add purified components

    • Monitor assembly using blue native PAGE (BN-PAGE)

    • Evaluate stability of subcomplex formation at 550 kDa

  • Proton transport assays:

    • Use pH-sensitive fluorescent dyes (ACMA, pyranine)

    • Monitor proton gradient formation across membranes

    • Quantify proton flux rates under different conditions

  • Functional coupling experiments:

    • Combine with F1 domain components to assess complete ATP synthase formation

    • Measure ATP synthesis rates using luciferase-based assays

    • Test effects of known ATP synthase inhibitors to confirm specificity

These approaches can be complemented by structural studies (cryo-EM, X-ray crystallography) to correlate function with structure.

What experimental approaches can be used to study MT-ATP6 under pathophysiological conditions?

Recent research has demonstrated the importance of studying ATP synthase under various pathophysiological conditions. Researchers can design experiments to examine Gorilla gorilla gorilla MT-ATP6 under such conditions using these approaches:

  • pH variation studies:

    • As demonstrated by Sharma's research, examining ATP synthase at acidic pH reveals unique conformational states

    • Create buffers at pH 3.8-7.0 to mimic physiological and pathological conditions

    • Use spectroscopic methods to detect conformational changes

  • Hypoxia-mimicking conditions:

    • Create oxygen-deficient environments using oxygen scavengers or hypoxia chambers

    • Monitor ATP synthesis efficiency under varying oxygen tensions

    • Assess structural stability using thermal shift assays

  • Disease-relevant mutations:

    • Introduce site-directed mutations corresponding to known pathological variants

    • Compare kinetic parameters between wild-type and mutant proteins

    • Assess assembly efficiency into larger complexes

  • Oxidative stress simulation:

    • Expose to controlled levels of reactive oxygen species

    • Quantify functional impairment and structural modifications

    • Identify oxidation-sensitive residues using mass spectrometry

The methodologies should include appropriate controls and multiple technical replicates to ensure reproducibility in these challenging experimental conditions.

How can researchers investigate the assembly of ATP synthase using recombinant MT-ATP6?

Investigating ATP synthase assembly is challenging but can be approached using several methodologies:

  • In vitro assembly systems:

    • Combine purified components in controlled reconstitution experiments

    • Monitor assembly intermediates using BN-PAGE

    • Apply crosslinking mass spectrometry to identify interaction interfaces

  • Pulse-chase experiments:

    • Track assembly kinetics using radioisotope or fluorescent labeling

    • Identify rate-limiting steps in the assembly process

    • Detect subassemblies and breakdown products

  • Interaction studies with assembly factors:

    • Investigate the role of chaperones like Hsp70 in assembly

    • Use pull-down assays to identify novel assembly factors

    • Quantify binding affinities using surface plasmon resonance

  • Time-resolved structural studies:

    • Employ hydrogen-deuterium exchange mass spectrometry

    • Use time-resolved cryo-EM to capture assembly intermediates

    • Develop fluorescence-based reporters for real-time assembly monitoring

Current understanding suggests that F1 and Fo domains assemble independently before joining to form the complete ATP synthase. Researchers should be aware that rapid turnover of Fo subunits and stator components can complicate these studies .

How do recent findings on ATP synthase at acidic pH inform research with Gorilla gorilla gorilla MT-ATP6?

The 2024 study by Sharma et al. examined ATP synthase at acidic pH levels just below neutral, revealing important insights that are relevant to research with Gorilla gorilla gorilla MT-ATP6:

  • Novel conformational states:

    • Four distinct conformations were identified in acidic environments

    • Three of these represent stages in the enzyme's reaction cycle

    • Two unique states were previously undescribed

  • Implications for disease research:

    • Mitochondria often become acidic in tissues affected by cancer and cardiac ischemia

    • These conditions cause oxygen deficiency (hypoxia)

    • Understanding ATP synthase behavior in acidified environments is crucial for disease modeling

  • Methodological advances:

    • The study demonstrates effective approaches for examining ATP synthase under non-standard conditions

    • Similar techniques could be applied to gorilla MT-ATP6 research

    • Comparative studies between human and gorilla proteins under acidic conditions might reveal evolutionary adaptations

  • Drug development relevance:

    • ATP synthase is already a drug target for various diseases including tuberculosis (bedaquiline)

    • Understanding conformational changes in acidic environments could inform drug design

    • Species-specific studies may identify unique targetable features

These findings suggest researchers should consider examining Gorilla gorilla gorilla MT-ATP6 under varying pH conditions to identify potential structural and functional variations that may have evolutionary or biomedical significance.

What role does Hsp70 play in ATP synthase assembly, and how might this affect studies with recombinant MT-ATP6?

Recent research has identified a previously unknown role for the molecular chaperone Hsp70 in ATP synthase assembly:

  • Dual functionality of Hsp70:

    • Beyond its known role as a protein folding helper in mitochondria

    • Now shown to promote the assembly of ATP synthase

    • This represents a significant expansion of our understanding of chaperone functions

  • Experimental implications:

    • Recombinant expression systems may lack appropriate chaperones

    • Co-expression with Hsp70 might improve proper folding and assembly

    • Researchers should consider chaperone supplementation in reconstitution experiments

  • Methodological considerations:

    • Assembly efficiency should be quantified with and without Hsp70

    • Structure and function correlations may differ depending on chaperone presence

    • In vitro vs. in vivo assembly pathways may show significant differences

  • Future research directions:

    • Comparative analysis of chaperone dependence across species

    • Identification of specific Hsp70 interaction sites on MT-ATP6

    • Development of optimized expression systems incorporating appropriate chaperones

This discovery highlights the complexity of ATP synthase assembly and suggests that optimal experimental designs should account for the role of molecular chaperones in ensuring proper protein folding and complex formation.

What are the current methodological challenges in studying proton translocation through MT-ATP6?

Proton translocation through MT-ATP6 is fundamental to ATP synthase function but presents several methodological challenges that researchers should consider:

  • Membrane protein reconstitution issues:

    • Achieving correct orientation in artificial membranes

    • Maintaining native-like lipid environments

    • Ensuring structural integrity during purification and reconstitution

  • Real-time measurement limitations:

    • Proton movement occurs at microsecond-to-millisecond timescales

    • Conventional pH indicators may lack sufficient temporal resolution

    • Signal-to-noise ratios can be problematic in complex systems

  • Coupling efficiency determination:

    • Distinguishing passive proton leakage from active translocation

    • Correlating proton movement with conformational changes

    • Quantifying the precise proton:ATP stoichiometry

  • Technical approaches to address these challenges:

    • Develop rapid-mixing stopped-flow systems with fluorescent indicators

    • Employ site-specific pH-sensitive probes at key residues

    • Use computational modeling to complement experimental data

    • Apply single-molecule techniques to observe individual proton translocation events

Experimental designs using chemiosmotic principles, as demonstrated in thylakoid studies , provide a framework for investigating proton translocation through MT-ATP6. By creating artificial gradients and monitoring ATP synthesis, researchers can elucidate the specific role of MT-ATP6 in the proton translocation pathway.

What are the emerging research trends for MT-ATP6 and ATP synthase studies?

Current research trends in the field of ATP synthase and MT-ATP6 are evolving in several key directions:

  • Structural biology advancements:

    • High-resolution cryo-EM structures revealing previously undetected conformational states

    • Time-resolved structural studies capturing the dynamics of rotary motion

    • Integration of structural data with functional measurements

  • Disease-focused investigations:

    • ATP synthase as a drug target for infectious diseases, cardiovascular conditions, and cancer

    • Study of ATP synthase behavior under pathophysiological conditions like acidosis and hypoxia

    • Exploration of mitochondrial diseases caused by MT-ATP6 mutations

  • Evolutionary perspectives:

    • Comparative analyses across species to identify conserved and divergent features

    • Investigation of environmental adaptations in ATP synthase function

    • Assessment of selection pressures on mitochondrial genes including MT-ATP6

  • Technological innovations:

    • Development of nanoscale sensors for real-time monitoring of ATP synthase activity

    • Application of artificial intelligence for predicting structure-function relationships

    • Advanced reconstitution systems mimicking native membrane environments

Researchers working with Gorilla gorilla gorilla MT-ATP6 can contribute to these trends by leveraging the evolutionary relationship between gorillas and humans to provide comparative insights into ATP synthase structure, function, and pathology.

How can recombinant Gorilla gorilla gorilla MT-ATP6 contribute to comparative studies of mitochondrial evolution?

Recombinant Gorilla gorilla gorilla MT-ATP6 offers unique opportunities for evolutionary studies:

  • Primate mitochondrial evolution:

    • Direct comparison with human MT-ATP6 can reveal recent evolutionary changes

    • Assessment of functional consequences of species-specific variations

    • Insights into selective pressures on mitochondrial genes in closely related species

  • Methodological approaches:

    • Side-by-side functional assays of recombinant proteins from different species

    • Chimeric constructs to identify regions responsible for species-specific properties

    • Directed evolution experiments to explore evolutionary pathways

  • Research applications:

    • Investigation of differential responses to environmental stressors

    • Comparison of assembly mechanisms and interaction with nuclear-encoded subunits

    • Assessment of susceptibility to pathogens or drugs that target ATP synthase

  • Broader evolutionary context:

    • Integration with phylogenetic analyses of mitochondrial genomes

    • Examination of co-evolution with interacting proteins

    • Insights into the evolution of bioenergetic systems in primates

These comparative studies can enhance our understanding of mitochondrial evolution and potentially inform anthropological research as well as biomedical applications related to mitochondrial function and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.