Recombinant Gorilla gorilla gorilla C-X-C chemokine receptor type 2 (CXCR2)

Shipped with Ice Packs
In Stock

Description

Production and Purification Methods

Recombinant gorilla CXCR2 is synthesized using multiple heterologous expression systems, each optimized for specific research applications:

Expression Systems

Product CodeSourceApplications
CSB-CF636722GGZE. coliStructural studies, ligand-binding assays .
CSB-YP636722GGZ1YeastHigh-throughput screening .
CSB-BP636722GGZ1BaculovirusPost-translational modification studies .
CSB-MP636722GGZ1Mammalian cellsFunctional signaling assays .

Purification typically involves affinity tags (e.g., GST, His-tag) and yields >90% purity, as validated by SDS-PAGE . Lyophilized formulations ensure stability for long-term storage .

Immune Response Modeling

  • Neutrophil chemotaxis: Recombinant gorilla CXCR2 is used to study cross-species neutrophil migration mechanisms, mirroring human inflammatory responses .

  • Ligand-receptor dynamics: Structural studies reveal that the N-terminus and extracellular loops govern ligand specificity, aiding drug design .

Therapeutic Development

  • Antagonist screening: Small-molecule inhibitors (e.g., AZD5069) are tested for efficacy in blocking CXCR2-mediated inflammation .

  • Biased signaling: Research focuses on dissociating anti-inflammatory benefits from adverse effects like neutropenia .

Evolutionary and Comparative Insights

  • Primate homology: Gorilla CXCR2’s near-identical sequence to human CXCR2 makes it a robust model for studying receptor-ligand interactions in inflammatory diseases .

  • Rodent limitations: Mice lack CXCL8 but respond to human IL-8 via Cxcr2, underscoring conserved signaling pathways despite ligand diversity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own applications.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CXCR2; IL8RB; C-X-C chemokine receptor type 2; CXC-R2; CXCR-2; High affinity interleukin-8 receptor B; IL-8R B; CD antigen CD182; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
FNMESDSFEDFWKGEDLSNYSYSSALPPFLLDASPCEPESLEINKYFVVIIYALVFLLSL LGNSLVILVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVS LLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLF RRTIYPSNVSPVCYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHM GQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHINQALDATEILG ILHSCLNPLIYAFIGQKFCHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHT
Uniprot No.

Target Background

Function
CXCR2 is a receptor for interleukin-8, a potent neutrophil chemotactic factor. Binding of IL-8 to the receptor triggers neutrophil activation. This response is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. CXCR2 binds to IL-8 with high affinity. It also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is gorilla CXCR2 and how does it compare structurally to human CXCR2?

Gorilla gorilla gorilla CXCR2 is a G protein-coupled receptor (GPCR) belonging to the chemokine receptor family. Similar to human CXCR2, it likely functions as a receptor for ELR+ CXC chemokines such as IL-8 (CXCL8) and CXCL1/GROα. While human CXCR2 is encoded on chromosome 2q35 and mediates neutrophil migration, angiogenesis, and inflammatory responses through Gαi-mediated pathways , gorilla CXCR2 would be expected to share significant sequence homology given the evolutionary closeness of the species.

To analyze structural similarities, researchers should perform:

  • Sequence alignment analysis comparing amino acid sequences

  • Homology modeling based on solved human CXCR2 structures

  • Analysis of conserved functional domains, particularly the chemokine-binding and G-protein coupling regions

The high conservation of GPCR structures among closely related primates suggests gorilla CXCR2 likely maintains similar binding pockets and signaling mechanisms as seen in human CXCR2 .

In which cell types and tissues is gorilla CXCR2 likely to be expressed?

Based on human CXCR2 expression patterns, gorilla CXCR2 would likely be predominantly expressed in:

  • Neutrophils (highest expression)

  • Endothelial cells

  • Macrophages

  • Oligodendrocytes

  • Neurons

  • Neural crest-derived cells

  • Certain cancer cell populations

To determine gorilla-specific expression patterns, researchers should employ:

  • Immunohistochemistry of gorilla tissue samples using validated anti-CXCR2 antibodies

  • Flow cytometry analysis of isolated gorilla immune cells

  • Single-cell RNA sequencing of gorilla tissues to identify cell-specific expression patterns

Understanding tissue-specific expression is crucial since CXCR2 knockouts in mice have revealed diverse roles beyond neutrophil function, including effects on central nervous system function, metabolism, reproduction, and circadian cycles .

What are the optimal systems for recombinant production of functional gorilla CXCR2?

For successful recombinant gorilla CXCR2 production, researchers should consider several expression systems, each with specific advantages:

Expression SystemAdvantagesConsiderations
HEK293 cellsMammalian glycosylation, proper foldingModerate yield, higher cost
CHO cellsIndustrial standard, stable lines possibleClone selection required
Sf9/Sf21 insect cellsHigher yield, cost-effective for GPCRsDifferent glycosylation patterns
E. coliHighest yield, lowest costRefolding often required, lacks post-translational modifications

Based on strategies used for human CXCR2, researchers should:

  • Include purification tags (His, FLAG) while ensuring they don't interfere with function

  • Consider solubilization strategies for this membrane protein using appropriate detergents

  • Verify protein quality by SDS-PAGE, Western blot, and size exclusion chromatography

For functional studies, human CXCR2 research demonstrates successful production of partial CXCR2 proteins for specific applications , which could be adapted for gorilla CXCR2.

How can the functionality of recombinant gorilla CXCR2 be verified?

Verification of recombinant gorilla CXCR2 functionality requires multiple complementary approaches:

  • Ligand Binding Assays:

    • Radiolabeled or fluorescently labeled chemokine binding studies

    • Competition binding assays with known CXCR2 ligands

    • Surface plasmon resonance to measure binding kinetics

  • Signaling Assays:

    • G-protein activation assays measuring GTPγS binding

    • Calcium flux measurements using fluorescent indicators

    • ERK/MAPK and AKT phosphorylation by Western blot

    • β-arrestin recruitment assays

  • Functional Cellular Responses:

    • Chemotaxis assays using transfected cell lines

    • Adhesion assays measuring receptor-mediated cell attachment

    • Signaling reporter gene assays

When validating gorilla CXCR2, researchers should compare responses to human CXCR2 under identical conditions, as functional differences may reveal important evolutionary adaptations in chemokine signaling .

What are the critical considerations when designing genetic modification studies involving gorilla CXCR2?

When genetically modifying cells to express gorilla CXCR2, researchers should consider:

  • Vector Selection:

    • Lentiviral vectors for stable integration and expression

    • Inducible promoters to control expression levels

    • Appropriate reporter genes to track transduction efficiency

  • Expression Control:

    • Codon optimization for the host cell system

    • Selection of promoters with appropriate strength

    • Inclusion of untranslated regions that enhance expression

  • Functional Validation:

    • Confirmation of surface expression by flow cytometry

    • Verification of signaling competence

    • Assessment of expected cellular responses

Human studies have demonstrated successful genetic modification of NK cells to express CXCR2, improving their migration along chemokine gradients and increasing tumor-killing capacity . Similar approaches could be adapted for gorilla CXCR2 studies to understand its potential in directing immune cell trafficking.

How can gorilla CXCR2 be utilized in comparative oncology and evolutionary studies?

Gorilla CXCR2 offers unique opportunities for comparative oncology and evolutionary research:

  • Evolutionary Analysis:

    • Sequence-based phylogenetic analysis of primate CXCR2 genes

    • Identification of positively selected residues indicating functional adaptations

    • Structural comparison to identify species-specific binding pocket differences

  • Comparative Oncology Applications:

    • Expression of gorilla CXCR2 in human cancer models to assess functional differences

    • Comparison of gorilla vs. human CXCR2 in neutrophil recruitment to tumors

    • Analysis of species-specific differences in angiogenic responses

  • Methodological Approach:

    • Generate cell lines expressing gorilla or human CXCR2

    • Subject these cells to identical tumor-derived chemokine gradients

    • Measure migration, infiltration, and functional responses

Research on human CXCR2 has revealed its significant role in numerous cancers, leading to evaluation of CXCR2 antagonists in preclinical and clinical studies . Comparative studies with gorilla CXCR2 may reveal evolutionary adaptations in cancer susceptibility among primates.

What insights might gorilla CXCR2 provide for understanding species-specific inflammatory responses?

Investigating gorilla CXCR2 in inflammatory contexts may reveal important species differences:

  • Comparative Inflammatory Models:

    • Parallel studies using gorilla and human CXCR2 in neutrophil models

    • Response comparisons to identical inflammatory stimuli

    • Species-specific differences in resolution of inflammation

  • Receptor Dynamics:

    • Internalization and recycling kinetics comparison

    • Desensitization and resensitization patterns

    • Biased signaling profiles between species

  • Experimental Approach:

    • Generate reporter cell lines expressing gorilla or human CXCR2

    • Stimulate with increasing concentrations of ligands

    • Measure downstream signaling activation patterns

    • Compare receptor trafficking using fluorescence microscopy

Human CXCR2 is implicated in chronic obstructive pulmonary disease (COPD), rheumatoid arthritis, and atherosclerosis . Understanding gorilla CXCR2 function might provide evolutionary insight into why certain inflammatory diseases appear to be more prevalent in humans compared to other great apes.

How does the signaling profile of gorilla CXCR2 compare with human CXCR2?

To characterize gorilla CXCR2 signaling compared to human CXCR2:

  • Key Signaling Pathways to Compare:

    • Gαi-mediated cAMP inhibition

    • MAPK activation kinetics and magnitude

    • PI3K/AKT pathway engagement

    • β-arrestin recruitment and signaling

  • Experimental Design:

    • Use identical cell backgrounds expressing either receptor

    • Stimulate with concentration series of the same ligands

    • Perform time-course analyses of signaling activation

    • Employ pathway inhibitors to determine signaling dependencies

  • Analysis Methods:

    • Phospho-specific Western blotting for key signaling proteins

    • BRET/FRET-based real-time interaction assays

    • Transcriptional reporter assays for downstream effects

    • Proteomics analysis of signaling complex formation

In human cells, CXCR2 triggers MAPK, PI3K/AKT, and β-arrestin signaling cascades . Species-specific differences in these pathways could reveal evolutionary adaptations in immune response regulation and provide insight into biased signaling mechanisms.

What are common challenges in recombinant gorilla CXCR2 expression and how can they be addressed?

Researchers working with recombinant gorilla CXCR2 may encounter several challenges:

  • Low Expression Levels:

    • Solution: Optimize codon usage for expression system

    • Test different signal peptides to improve membrane targeting

    • Use chaperone co-expression to aid folding

  • Protein Misfolding:

    • Solution: Adjust culture temperature (typically lower)

    • Add chemical chaperones to culture media

    • Consider fusion partners that enhance folding

  • Functional Inactivity:

    • Solution: Verify glycosylation status

    • Ensure appropriate membrane integration

    • Optimize detergent selection for solubilization

  • Aggregation During Purification:

    • Solution: Screen detergent/lipid combinations

    • Implement stepwise purification protocol

    • Consider nanodiscs or other membrane mimetics

Based on experience with human CXCR2, researchers should pay particular attention to maintaining the native conformation during purification, as this is critical for preserving ligand binding capacity and functional activity .

How should researchers address data variability in cross-species CXCR2 comparative studies?

When comparing gorilla and human CXCR2 function:

  • Source of Variability:

    • Expression level differences

    • Cell background effects

    • Ligand preparation variations

    • Assay-specific fluctuations

  • Experimental Controls:

    • Include receptor expression level quantification

    • Use internal reference standards

    • Perform paired experiments (same day/reagents)

    • Include multiple technical and biological replicates

  • Data Normalization Strategies:

    • Normalize to receptor expression levels

    • Use relative response ratios to standard ligands

    • Apply appropriate statistical methods for paired comparisons

    • Consider developing species-specific correction factors

  • Reporting Recommendations:

    • Clearly document all normalization procedures

    • Report both raw and normalized data

    • Include statistical power calculations

    • Address potential confounding variables

Researchers should recognize that studies on human CXCR2 demonstrate that context-dependent variables significantly impact receptor function , making standardized experimental approaches essential for valid cross-species comparisons.

What bioinformatic approaches are most effective for predicting gorilla CXCR2 interactions and functions?

To predict gorilla CXCR2 interactions and functions computationally:

  • Sequence-Based Methods:

    • Multiple sequence alignment with other primate CXCR2 proteins

    • Identification of conserved functional motifs

    • Prediction of post-translational modification sites

    • Analysis of polymorphisms and their functional implications

  • Structural Prediction Approaches:

    • Homology modeling based on human CXCR2 structure

    • Molecular docking of putative ligands

    • Molecular dynamics simulations to assess binding stability

    • Identification of critical binding residues

  • Recommended Software and Databases:

    • SWISS-MODEL for homology modeling

    • AutoDock or Rosetta for ligand docking

    • GROMACS for molecular dynamics

    • UniProt, LOVD, and species-specific databases for sequences

  • Validation Strategy:

    • Correlate predictions with experimental binding data

    • Test computationally identified key residues by mutagenesis

    • Compare predictions across multiple algorithms

Researchers should consider that in humans, understanding CXCR2 function and phenotype depends on understanding the shared and distinct properties of its ligands and how they are shaped by the local environment , suggesting similar complexity in gorilla CXCR2 interactions.

What are the most promising applications for comparative CXCR2 research across primate species?

Comparative CXCR2 research across primates, including gorillas, offers several promising research directions:

  • Evolutionary Immunology:

    • Investigation of selection pressures on CXCR2 across primates

    • Correlation with pathogen exposure and disease susceptibility

    • Understanding evolutionary trade-offs in inflammatory responses

  • Disease Susceptibility:

    • Comparative studies of CXCR2 function in inflammatory diseases

    • Investigation of why certain CXCR2-associated diseases show different prevalence across primates

    • Identification of protective or risk-enhancing receptor variants

  • Therapeutic Development:

    • Use of gorilla CXCR2 to identify conserved druggable sites

    • Development of broader-spectrum antagonists

    • Testing species-specificity of existing CXCR2-targeting compounds

  • Methodological Approach:

    • Generate parallel cell models expressing CXCR2 from different primates

    • Challenge with identical stimuli and measure responses

    • Perform cross-species transplantation experiments

Human CXCR2 research has led to development of small-molecule antagonists (e.g., AZD5069, navarixin) and monoclonal antibodies for inflammatory diseases and cancer . Cross-species studies could enhance understanding of the evolutionary conservation of drug binding sites.

How might genetic engineering of gorilla CXCR2 advance understanding of immune cell trafficking?

Genetic engineering approaches with gorilla CXCR2 could provide significant insights:

  • Immune Cell Engineering:

    • Transduction of human or gorilla immune cells with gorilla CXCR2

    • Assessment of migration toward species-specific chemokine gradients

    • Comparison of adhesion, extravasation, and target cell engagement

  • Chimeric Receptor Studies:

    • Creation of human-gorilla CXCR2 chimeras

    • Identification of domains responsible for species-specific functions

    • Analysis of regulatory mechanisms affecting receptor activity

  • Experimental Approaches:

    • Lentiviral or CRISPR-based engineering systems

    • In vitro migration and functional assays

    • Adoptive transfer experiments in appropriate models

Studies with human NK cells have demonstrated that genetic modification to express CXCR2 improves their migration along chemokine gradients, resulting in increased killing of target cells . Similar approaches with gorilla CXCR2 could reveal evolutionary adaptations in immune cell trafficking mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.