Recombinant Gorilla gorilla gorilla C5a anaphylatoxin chemotactic receptor (C5AR1)

Shipped with Ice Packs
In Stock

Description

Production and Validation

Recombinant Gorilla C5AR1 is produced using heterologous expression systems, with validated specifications:

Product CodeExpression SystemPurityApplications
CSB-CF003996GGZ E. coli≥85%Ligand binding assays, ELISA
CSB-YP003996GGZ1 Yeast≥85%Structural studies, WB
CSB-MP003996GGZ1 Mammalian cells≥85%Cell signaling assays

Key validation data:

  • Specificity: Reactivity confirmed via SDS-PAGE and Western blot using anti-His monoclonal antibodies

  • Activity: Binds C5a with Kd values comparable to human C5AR1 (low nM range)

  • Cross-reactivity: Recognized by antibodies raised against human C5AR1 due to high sequence homology

Disease Modeling

  • Sepsis: C5AR1 blockade in murine models reduced mortality by enhancing pathogen clearance and preserving liver function .

  • COVID-19: Elevated C5a-C5AR1 signaling correlates with severe lung inflammation; recombinant proteins aid in studying alveolar injury mechanisms .

  • Cardiac Regeneration: C5AR1 inhibition attenuates cardiomyocyte proliferation post-injury in zebrafish, axolotl, and neonatal mouse models .

Therapeutic Development

Recombinant Gorilla C5AR1 is used to screen inhibitors like:

DrugPhaseTarget Disease
Avacopan ApprovedANCA-associated vasculitis
PMX-53 Phase 2Atopic dermatitis
PMX205 PreclinicalNeurodegenerative disorders

Challenges and Future Directions

  • Immunogenicity: Non-human primate-derived proteins may trigger immune responses in humanized models .

  • Functional variability: Post-translational modifications differ across expression systems, affecting ligand affinity .

  • Therapeutic potential: Ongoing trials explore C5AR1 antagonists for cancer immunotherapy and COVID-19-related acute lung injury .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
C5AR1; C5AR; C5R1; C5a anaphylatoxin chemotactic receptor 1; C5a anaphylatoxin chemotactic receptor; C5a-R; C5aR; CD antigen CD88
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-350
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
MDSFNYTTPDYGHYDDKDTLDPNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW VTAFEVKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACRILPSLILLNM YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE YFPPKVLCGVDYSHDKQRERAVAVVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAEKTQAV
Uniprot No.

Target Background

Function
The C5a anaphylatoxin chemotactic receptor (C5AR1) is a receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region that triggers downstream signaling events. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release, and superoxide anion production.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.