Recombinant Gorilla gorilla gorilla Duffy antigen/chemokine receptor (DARC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Gorilla gorilla gorilla Duffy Antigen/Chemokine Receptor (DARC)

The Duffy antigen/chemokine receptor (DARC), also known as ACKR1, is a 7-transmembrane (7TM) protein that functions as a promiscuous chemokine receptor and a receptor for Plasmodium vivax in erythrocytes. In gorillas (Gorilla gorilla gorilla), DARC is encoded by the ACKR1 gene and shares structural and functional similarities with its human counterpart. Recombinant gorilla DARC refers to genetically engineered versions of this protein, often expressed in heterologous systems (e.g., HEK293 cells) to study its interactions, evolutionary adaptations, and role in disease resistance.

Key Features:

  • 7TM Architecture: Conserved across primates, with a promiscuous chemokine-binding N-terminal domain and a truncated intracellular region lacking G-protein coupling motifs .

  • Evolutionary Significance: Gorilla DARC exhibits fixed mutations (e.g., V25A) and polymorphisms in the P. vivax binding region, distinct from human FY*A/B/O alleles .

  • Functional Roles: Binds CC and CXC chemokines (e.g., CCL5, CXCL8) but lacks signaling via G-proteins or β-arrestin, instead mediating chemokine transcytosis .

Functional Properties and Ligand Interactions

Recombinant gorilla DARC retains critical functional properties, though structural divergences influence ligand specificity:

Chemokine Binding

  • Promiscuous Affinity: Binds CC (e.g., CCL2, CCL5) and CXC (e.g., CXCL8, CXCL7) chemokines via the N-terminal domain .

  • Structural Basis: Cryo-EM studies of human DARC-CCL7 complexes reveal superficial binding, with the N-terminal domain forming the primary interaction interface . Gorilla DARC likely employs a similar mechanism.

Plasmodium vivax Interaction

  • DBP Binding: The N-terminal domain binds P. vivax Duffy Binding Protein (DBP), enabling erythrocyte invasion .

  • Mutational Impact: The V25A mutation in gorilla DARC may reduce DBP affinity compared to human DARC, contributing to resistance in non-human primates .

Signal Transduction

  • Non-Signaling: Lacks the DRYLAIV motif and intracellular domains for G-protein or β-arrestin coupling .

  • Transcytosis: Mediates chemokine internalization and apical retention, modulating leukocyte migration .

Evolutionary Insights and Comparative Analysis

Gorilla DARC diverges from human DARC in key regions (Table 2).

RegionHuman DARCGorilla DARCFunctional Implication
N-TerminalAsn42 (FY*A/B)Asp42 (N42D SNP)Altered P. vivax DBP binding .
TM1Val25Ala25 (fixed V25A mutation)Structural stability, ligand recognition .
PromoterFY*O (GATA-1 mutation)No null allele detectedNo erythrocyte-specific expression loss .

Selection Pressures:

  • Human DARC: Strong positive selection for FY*O in Africa (malaria resistance) .

  • Gorilla DARC: Fixed V25A and N42D mutations suggest adaptation to P. vivax or other pathogens .

Research Applications and Experimental Models

Recombinant gorilla DARC is used in:

  1. Malaria Resistance Studies:

    • Testing DBP binding and P. vivax invasion efficiency .

    • Comparing human and gorilla DARC mutations to map critical residues for pathogen interaction .

  2. Chemokine Regulation:

    • Investigating transcytosis mechanisms in endothelial cells .

    • Developing therapeutic strategies to modulate inflammation .

  3. Structural Biology:

    • Cryo-EM or NMR studies to resolve species-specific ligand-binding modes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ACKR1; DARC; FY; Atypical chemokine receptor 1; Duffy antigen/chemokine receptor; CD antigen CD234
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
MGNCLHTAELSPSTENSSQLDFEDAWNSSYDVNYSFPDVDYDANLEAAAPCHSCNLLDDS ALPFFILTSVLGILASSTVLFILFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPILAPGL GSTHSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALL TLPVTLASGASGGLCTPIHSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPG PWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVAT PLILALFYHQATRTLLPSLPLPEGWSSHLDTLGSKS
Uniprot No.

Target Background

Function
DARC (Duffy antigen/chemokine receptor) is an atypical chemokine receptor that regulates chemokine levels and localization. It binds chemokines with high affinity but does not initiate typical ligand-driven signaling pathways. Instead, it sequesters, degrades, or transcytoses chemokines. DARC is also known as interceptor (internalizing receptor), chemokine-scavenging receptor, or chemokine decoy receptor. It exhibits a broad chemokine-binding profile, interacting with inflammatory chemokines from both the CXC and CC subfamilies, but not with homeostatic chemokines. It acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, and TARC. DARC may regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it facilitates the transcytosis of tissue-derived chemokines from the abluminal to the luminal side, presenting them to circulating leukocytes; when expressed in erythrocytes, it acts as a blood reservoir for cognate chemokines, but also as a chemokine sink, mitigating potential surges in plasma chemokine levels.
Database Links
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Subcellular Location
Early endosome. Recycling endosome. Membrane; Multi-pass membrane protein.

Q&A

What is the Duffy antigen/chemokine receptor (DARC) and what is its significance in primates?

The Duffy antigen/chemokine receptor (DARC) is a glycoprotein initially identified as a blood group antigen expressed on the surface of erythrocytes (red blood cells). DARC has gained significant research attention for two primary reasons: it serves as an entry receptor for certain malarial parasites, including Plasmodium vivax and P. knowlesi, and it functions as a multispecific receptor for chemokines. Despite lacking the ability to couple with G proteins and initiate traditional signaling cascades, DARC binds with high affinity to both CXC chemokine family members (such as MGSA/GRO, IL-8, and NAP-2) and CC chemokine family members (including MCP-1 and RANTES) .

In primates, including Gorilla gorilla gorilla (Western lowland gorilla), DARC is evolutionarily conserved with significant homology to human DARC. The protein plays roles in both immunobiology and potentially neurobiology, with expression patterns that suggest important physiological functions .

How does the structure of Gorilla gorilla gorilla DARC compare to human DARC?

Gorilla gorilla gorilla DARC shares high sequence homology with human DARC, reflecting their close evolutionary relationship. While specific homology percentages between human and gorilla DARC are not directly provided in the available research, we can contextualize this relationship through comparison with other primates. Human and chimpanzee DARC exhibit 99% homology with only a single residue change at position 116 (valine to isoleucine). Lower but still significant homology exists between human DARC and that of more distantly related primates: 94% homology with squirrel and rhesus monkeys, and 93% homology with aotus monkey .

The amino acid sequence of Gorilla gorilla gorilla DARC (Q95LF9) includes 338 amino acids, with distinctive regions that contribute to its chemokine binding and receptor functions. The N-terminal exocellular domain is particularly important for antibody and malarial parasite specificities .

What is the genetic structure of the DARC gene in gorillas compared to humans?

In humans, the coding and untranslated flanking sequences of the Duffy gene (FY) are contained within a single exon. Human DARC has two codominant alleles, FYA and FYB, which differ by a single nucleotide at position 306 (guanidine in FYA and adenine in FYB). This produces a codon change that modifies amino acid 43 of the major DARC subunit (glycine in Fya and aspartic acid in Fyb) .

Though the specific genetic structure of gorilla DARC is not detailed in the search results, the high conservation of this gene across primates suggests a similar single-exon structure. Research on the genetics of DARC in non-human primates provides important insights into the evolution of this receptor and its role in malaria susceptibility .

How does DARC relate to malaria susceptibility in gorillas versus humans?

The relationship between DARC and malaria susceptibility represents one of the most fascinating aspects of this receptor's biology. In humans, Duffy negativity (lack of DARC expression on erythrocytes) is common in African populations and provides protection against Plasmodium vivax infection, as the parasite cannot invade Duffy-negative red blood cells .

Recent research suggests that gorillas and other African great apes may serve as natural hosts for P. vivax-like parasites. This raises intriguing questions about DARC's role in these infections. Studies have found parasites with mitochondrial genomes closely resembling P. vivax in these primates, suggesting they might maintain a reservoir of P. vivax or P. vivax-like parasites in regions where the human population is predominantly Duffy-negative .

The finding that some apparently Duffy-negative humans can be infected with P. vivax further complicates our understanding of DARC-malaria interactions, suggesting alternative invasion pathways may exist or that the parasite is evolving to overcome this barrier .

What experimental methods are recommended for studying recombinant Gorilla gorilla gorilla DARC?

Researchers investigating recombinant Gorilla gorilla gorilla DARC can employ several methodological approaches, depending on their specific research questions:

  • Binding Assays: Radioligand binding assays using 125I-labeled chemokines (such as MGSA, IL-8, MCP-1, or RANTES) to assess binding affinities and specificities of gorilla DARC compared to human DARC .

  • Cross-linking Experiments: Chemical cross-linking with labeled chemokines followed by SDS-PAGE analysis to determine molecular weight and structural properties .

  • Transfection Studies: Expression of cloned gorilla DARC cDNA in cell lines (such as K562 or 293 cells) that normally lack DARC expression, followed by functional studies .

  • Immunohistochemistry: Using anti-Duffy antibodies (such as anti-Fy6) to examine tissue expression patterns in gorilla samples, with appropriate controls to ensure specificity .

  • PCR and Sequencing: Molecular analysis of gorilla DARC using species-specific primers, such as those designed at functional junctions of the protein .

When working with recombinant Gorilla gorilla gorilla DARC protein, researchers should store it at -20°C in Tris-based buffer with 50% glycerol. For extended storage, -80°C is recommended, and repeated freeze-thaw cycles should be avoided .

How can researchers design experiments to compare chemokine binding properties between human and gorilla DARC?

To effectively compare chemokine binding properties between human and gorilla DARC, researchers should consider a comprehensive experimental approach:

  • Competitive Binding Assays: Using a panel of chemokines (both CXC and CC families) at various concentrations to determine binding affinities (Kd values) and compare these between human and gorilla DARC. This allows for the identification of potential species-specific differences in chemokine preferences .

  • Receptor Internalization Studies: Examining whether chemokine binding induces receptor internalization in both human and gorilla DARC, as this process has been documented for human DARC despite its inability to couple to G proteins .

  • Site-Directed Mutagenesis: Creating chimeric receptors or point mutations to identify specific amino acid residues responsible for any observed differences in binding properties between human and gorilla DARC .

  • Functional Readouts in Transfected Cells: Comparing downstream effects of chemokine binding to human versus gorilla DARC in transfected cell lines, focusing on aspects such as receptor internalization, potential signaling events, or interactions with other cellular components .

  • Structural Studies: Using techniques like X-ray crystallography or cryo-electron microscopy to compare the three-dimensional structures of human and gorilla DARC, particularly when bound to various chemokines .

These comparative studies can provide valuable insights into the evolutionary conservation and divergence of DARC function across primate species.

What are the key considerations when using recombinant Gorilla gorilla gorilla DARC in malaria research?

Researchers utilizing recombinant Gorilla gorilla gorilla DARC in malaria research should consider several important factors:

  • Parasite-Receptor Interactions: Studies should examine the binding affinity of various Plasmodium species' Duffy binding proteins (particularly from P. vivax and P. knowlesi) to gorilla DARC compared to human DARC. This can provide insights into host specificity and the evolution of parasite-host interactions .

  • Invasion Inhibition Assays: Researchers can investigate whether gorilla DARC supports invasion by human-infective Plasmodium species, and whether chemokines that bind to DARC (such as MGSA, IL-8, or MGSA-E6A) can block this invasion, as has been demonstrated with human DARC .

  • Structural Determinants: The N-terminal exocellular domain is critical for parasite binding. Comparative analysis of this region between human and gorilla DARC can identify amino acids critical for species-specific interactions with malarial parasites .

  • Zoonotic Potential: Given evidence that African great apes may serve as reservoirs for P. vivax-like parasites, research using gorilla DARC can help assess the zoonotic potential of these parasites and the risk to Duffy-positive humans who enter areas where these apes are present .

  • Evolutionary Context: Studies should consider the evolutionary pressures that have shaped DARC in different primate species, particularly in the context of malarial parasites as selective agents .

These considerations can guide research aimed at understanding the complex relationship between DARC, malarial parasites, and the evolution of resistance mechanisms.

What are the molecular mechanisms underlying DARC's dual function as both a chemokine receptor and malaria parasite entry point?

The dual functionality of DARC as both a chemokine receptor and malaria parasite entry point presents a fascinating research area. Current understanding suggests that both functions involve the N-terminal extracellular domain of DARC, though possibly through distinct binding sites or conformational states.

For malaria parasite interaction, specific domains of the Plasmodium Duffy binding proteins interact with DARC, facilitating erythrocyte invasion. Interestingly, certain chemokines (MGSA, IL-8, and MGSA-E6A) can block invasion of Duffy-positive RBCs by P. knowlesi, suggesting overlapping binding sites or conformational interference between chemokines and parasite proteins .

Advanced structural studies and mutation analyses comparing gorilla and human DARC could further elucidate these molecular mechanisms and potentially identify species-specific differences in these interactions .

How has DARC evolved across primate species, and what does this reveal about selective pressures from malaria?

The evolution of DARC across primate species provides compelling evidence for selective pressures exerted by malarial parasites. Comparative analysis reveals high conservation of DARC sequence among primates, with 99% homology between humans and chimpanzees, and 93-94% homology between humans and more distantly related monkeys .

In human populations, the Duffy-negative phenotype (resulting from a mutation in the promoter region that prevents erythrocyte expression) is nearly universal in West and Central Africa, where P. vivax malaria has historically been endemic. This represents a classic example of positive selection, where the loss of DARC expression on red blood cells provides protection against P. vivax infection .

The discovery that African great apes, including gorillas, harbor P. vivax-like parasites raises intriguing questions about the evolutionary dance between hosts and parasites. These primates may serve as natural reservoirs for P. vivax or P. vivax-like parasites, maintaining transmission in regions where human populations are predominantly Duffy-negative .

Advanced research into gorilla DARC can help reconstruct this evolutionary history, potentially revealing how different primate lineages have responded to malarial parasites through modifications of DARC structure, expression, or function.

What are the optimal storage and handling conditions for recombinant Gorilla gorilla gorilla DARC protein?

For optimal research outcomes when working with recombinant Gorilla gorilla gorilla DARC protein, researchers should adhere to the following storage and handling recommendations:

Following these guidelines will help ensure consistent and reliable results when working with this specialized recombinant protein.

What methodological challenges exist in studying the expression patterns of DARC in gorilla tissues?

Investigating DARC expression patterns in gorilla tissues presents several methodological challenges that researchers must carefully navigate:

  • Tissue Availability: Obtaining gorilla tissue samples for research is extremely limited due to the endangered status of these animals. Researchers typically must rely on opportunistic sampling from animals that have died of natural causes in captivity or veterinary procedures .

  • Antibody Cross-Reactivity: While anti-human DARC antibodies (like anti-Fy6) might cross-react with gorilla DARC due to high sequence homology, this cross-reactivity needs to be validated. Some epitopes might differ between species, potentially affecting staining specificity and intensity .

  • Tissue Preservation: The quality of gorilla tissue samples may be compromised due to delayed collection after death or suboptimal preservation methods in field conditions, potentially affecting the detection of DARC expression through immunohistochemistry or RNA analysis .

  • Controls: Establishing appropriate positive and negative controls for gorilla tissues is challenging. Researchers must carefully design control experiments to validate their findings, potentially using tissues from other primates with known DARC expression patterns as comparators .

  • Regulatory Considerations: Research involving great ape tissues is subject to strict regulatory oversight and ethical considerations. Researchers must navigate complex approval processes and ensure all work complies with conservation regulations and ethical standards .

These challenges require innovative approaches, such as developing gorilla-specific reagents or adapting existing methodologies to work with limited or suboptimal samples.

How can researchers address potential contamination issues when working with recombinant DARC proteins?

Contamination issues represent a significant challenge when working with specialized recombinant proteins like Gorilla gorilla gorilla DARC. Researchers should implement the following strategies to minimize these risks:

  • Sterile Technique: Always handle recombinant proteins using aseptic technique in a clean environment, preferably in a laminar flow hood or biosafety cabinet. Use sterile pipettes, tubes, and reagents dedicated to protein work .

  • Endotoxin Testing: Before using recombinant DARC in sensitive applications (such as cell-based assays), test for endotoxin contamination, which can significantly affect experimental outcomes, particularly in immunological studies .

  • Protein Purity Assessment: Verify the purity of recombinant DARC using SDS-PAGE, Western blotting, or mass spectrometry. Contaminating proteins may interfere with binding assays or other functional studies .

  • Tag Interference Evaluation: Recombinant proteins often contain tags for purification purposes. These tags may influence protein folding or function, potentially complicating the interpretation of experimental results. Consider using tag-free proteins or implementing appropriate controls to account for tag effects .

  • Protein Aggregation Monitoring: DARC is a membrane protein that may form aggregates during purification or storage. Use techniques like dynamic light scattering or size exclusion chromatography to assess aggregation, which can affect binding properties and functional assays .

  • Cross-contamination Prevention: When working with multiple protein preparations, implement strict separation protocols to prevent cross-contamination between human and gorilla DARC samples or between DARC and other proteins .

By addressing these potential contamination issues proactively, researchers can enhance the reliability and reproducibility of their findings when working with recombinant Gorilla gorilla gorilla DARC.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.