Recombinant Gorilla gorilla gorilla Fibroblast growth factor

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

Recombinant gorilla FGF is synthesized using an in vitro E. coli expression system, ensuring high purity (>85% by SDS-PAGE) and bioactivity . Key specifications include:

PropertyDetails
OrganismGorilla gorilla gorilla (Western lowland gorilla)
Expression HostEscherichia coli
TagN-terminal 10xHis-tag for purification
Molecular Weight22.2 kDa
Protein SequenceHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Isoelectric Point (pI)Not explicitly stated; inferred from sequence homology to human FGFs (~9–10)
Delivery FormLiquid (Tris/PBS buffer with glycerol) or lyophilized powder (Trehalose buffer)

Production and Quality Control

The recombinant protein is expressed in E. coli, purified via affinity chromatography (His-tag), and validated for bioactivity .

Key Production Metrics

ParameterDetails
Purity>85% (SDS-PAGE)
Buffer CompositionLiquid: Tris/PBS + 5–50% glycerol; Lyophilized: Tris/PBS + 6% Trehalose
ReconstitutionSterile water, followed by aliquoting and storage at -20°C/-80°C
Stability6 months (liquid), 12 months (lyophilized) at -20°C/-80°C
Endotoxin TestingNot routinely tested; research-grade only

Research Applications

While direct studies on gorilla FGF are sparse, insights from homologous FGFs highlight potential uses:

In Vitro and Ex Vivo Studies

  • Cell proliferation assays: Human and primate FGFs (e.g., FGF-7) stimulate epithelial cell growth at ED50 values of 6–60 ng/mL .

  • Skin penetration studies: Lipid-encapsulated FGF-1 penetrates up to 90 µm into the stratum corneum, suggesting utility in topical formulations .

Therapeutic Development

  • Metabolic disorders: Engineered FGF21 analogs exhibit prolonged half-life and efficacy in glucose regulation .

  • Dermatology: FGF-1 reduces wrinkle depth and improves skin elasticity in vivo .

Comparative Analysis with Primate FGFs

FeatureGorilla FGFHuman FGF-7 (KGF)Rhesus FGF-21 Analogs
Expression SystemE. coliMammalian cellsE. coli or mammalian systems
Receptor SpecificityLikely FGFR1–4FGFR2-IIIbβ-Klotho-dependent
Stability EnhancementsLyophilization with Trehalose PEGylation or Fc fusion Avimer scaffolds
Cross-Species ActivityPresumed (based on homology)Active in rhesus models Species-specific modifications

Unanswered Questions and Future Directions

  • Functional studies: Direct assays measuring gorilla FGF’s mitogenic activity in primate cell lines.

  • Structural analysis: X-ray crystallography to compare binding domains with human FGFs.

  • Therapeutic optimization: Engineering gorilla FGF for enhanced stability (e.g., PEGylation) or tissue targeting .

Product Specs

Buffer
Lyophilized from a Tris/PBS-based buffer containing 6% Trehalose.
Form
Available as liquid or lyophilized powder.
Note: While we prioritize shipping the available format, please specify your preferred format in order notes to ensure fulfillment.
Lead Time
3-7 business days
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tag.
Datasheet & Coa
Please contact us to get it.
Expression Region
29-209aa
Mol. Weight
22.2 kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Q&A

What is Recombinant Gorilla gorilla gorilla Fibroblast growth factor?

Recombinant Gorilla gorilla gorilla Fibroblast growth factor is a purified protein produced in E. coli expression systems that replicates the native FGF found in Western lowland gorillas. The commercially available protein typically has >85% purity as determined by SDS-PAGE analysis and includes an N-Terminal 10Xhis-Tag. The recombinant protein encompasses the expression region of amino acids 29-209 with a theoretical molecular weight of 22.2kDa . This recombinant form allows researchers to study gorilla-specific FGF without the need to collect primary samples from endangered species, facilitating comparative studies across primates.

What are appropriate experimental controls when working with gorilla FGF?

When designing experiments with Recombinant Gorilla gorilla gorilla Fibroblast growth factor, several controls should be implemented:

Control TypeExamplePurpose
Species-matched negativeBuffer-only treatmentEstablish baseline responses
Species-matched positiveKnown gorilla growth factorConfirm cell responsiveness
Cross-species referenceHuman FGF equivalentAssess evolutionary conservation
Receptor blockingFGF receptor antagonistConfirm signaling specificity
Tag-only controlHis-tag peptideEliminate tag interference effects

Additionally, time-course and dose-response experiments should be conducted to determine optimal experimental conditions, as gorilla FGF may exhibit different kinetics compared to more commonly studied human variants .

What are the optimal storage and handling conditions for gorilla FGF?

Recombinant Gorilla gorilla gorilla Fibroblast growth factor requires specific handling protocols to maintain biological activity. The protein should be stored at -20°C and repeated freeze/thaw cycles should be strictly avoided to prevent denaturation and activity loss. For liquid formulations, the standard buffer typically consists of Tris/PBS-based solutions with 5%-50% glycerol. When provided as lyophilized powder, reconstitution should be performed in Tris/PBS-based buffer (pH 8.0) containing 6% Trehalose . Working aliquots should be prepared during initial thawing to minimize repeated freeze-thaw cycles. Activity assays should be performed before and after extended storage periods to verify protein functionality. Temperature monitoring during shipping and handling is critical, as protein degradation can occur rapidly at room temperature.

How should researchers design dose-response experiments with gorilla FGF?

Designing dose-response experiments with Recombinant Gorilla gorilla gorilla Fibroblast growth factor requires:

  • Concentration range determination: Begin with a broad concentration range (e.g., 0.1-100 ng/mL) based on known effective doses of related FGFs

  • Cell type selection: Choose both gorilla-derived cell lines (when available) and human/primate cell lines for comparative analysis

  • Temporal considerations: Assess both acute (minutes to hours) and chronic (days) exposure effects

  • Receptor saturation analysis: Include super-physiological doses to determine maximal responses

  • Signaling pathway documentation: Monitor downstream effectors (ERK1/2, AKT) via western blotting at each concentration

  • Statistical analysis: Apply non-linear regression to determine EC50 values and Hill coefficients

The dose-response relationship may differ significantly between cell types due to varying receptor expression levels and signal transduction mechanisms. Researchers should consider parallel experiments with human FGF to establish comparative efficacy profiles .

What methodologies are recommended for studying gorilla FGF in developmental contexts?

For developmental studies involving Recombinant Gorilla gorilla gorilla Fibroblast growth factor, several complementary approaches are recommended:

  • Organoid models: Gorilla-derived iPSC cerebral organoids provide valuable systems to study FGF's role in primate neurogenesis and can be directly compared with human organoids to identify species-specific effects .

  • HERO culture systems: Hemisphere rotation cultures allow for the analysis of basal processes and other morphological features influenced by growth factors during development .

  • Comparative transcriptomics: RNA-seq analysis before and after FGF treatment can identify species-specific transcriptional responses across developmental timepoints.

  • Live-cell imaging: Fluorescently tagged basal progenitor cells can be monitored for division patterns and morphological changes in response to gorilla FGF.

  • Cross-species transplantation: Gorilla FGF-treated cells can be transplanted into mouse models to assess functional integration and developmental potential.

Recent studies have demonstrated that EPIREGULIN, another growth factor expressed in both gorilla and human cerebral organoids, influences basal progenitor proliferation . Similar experimental design principles can be applied when studying gorilla FGF's role in developmental processes.

How can researchers distinguish between direct effects of gorilla FGF and indirect effects mediated through secondary signaling cascades?

Distinguishing direct from indirect effects of Recombinant Gorilla gorilla gorilla Fibroblast growth factor requires sophisticated experimental approaches:

  • Temporal signaling analysis: Map activation patterns of downstream effectors (MAPK, PI3K/AKT, PLCγ) using phospho-specific antibodies at multiple timepoints (seconds to hours) after FGF exposure.

  • Selective pathway inhibition: Apply pharmacological inhibitors (e.g., U0126 for MEK/ERK, LY294002 for PI3K) to block specific pathways and assess which FGF-induced effects persist.

  • Receptor mutagenesis: Generate cells expressing FGFR mutants with altered binding sites or signaling domains to isolate receptor-specific responses.

  • Transcriptional profiling with actinomycin D: Block new transcription to distinguish between immediate (direct) versus delayed (indirect) gene expression changes.

  • Conditioned media experiments: Transfer media from FGF-treated cells to untreated cells to identify secreted mediators of indirect effects.

These approaches can reveal whether observed effects, such as increased basal progenitor proliferation, represent direct activation of FGF receptors or secondary responses mediated through induced cytokines or other signaling molecules .

What evolutionary insights can be gained from comparing gorilla FGF with other primate FGF variants?

Comparative analysis of gorilla FGF with other primate variants provides significant evolutionary insights:

The emergence of the fibroblast growth factor family, particularly the keratinocyte growth factor (KGF) multigene family, occurred during critical evolutionary windows. Research indicates that the primordial KGF gene underwent amplification and chromosomal dispersion after orangutan divergence but before the trichotomous divergence of humans, chimpanzees, and gorillas approximately 5-8 million years ago . This timing suggests that changes in growth factor signaling may have contributed to unique developmental features in great apes.

Multiple copies of KGF-like genes have been discovered in the genomic DNA of chimpanzees and gorillas, but are notably absent in lesser apes (gibbons), Old World monkeys, mice, and chickens . This pattern suggests that the expansion of the FGF gene family may have played a role in the evolution of specific traits in great apes and humans.

Detailed sequence analysis reveals three distinct classes of KGF-related coding sequences in humans that differ by approximately 5% from each other and from the authentic KGF sequence . Determining whether similar variation exists in gorilla FGF genes would provide further insight into how these signaling molecules evolved in parallel across closely related species.

How can researchers effectively use chimeric FGF constructs to study domain-specific functions?

Chimeric FGF constructs provide powerful tools for dissecting domain-specific functions:

  • Design strategy: Create fusion proteins combining domains from gorilla FGF with corresponding regions from human or other primate FGFs to isolate functional elements.

  • Expression systems: Utilize E. coli expression systems with appropriate chaperones to ensure proper folding of chimeric constructs, following similar protocols to those used for producing Recombinant Gorilla gorilla gorilla Fibroblast growth factor .

  • Functional assays: Test chimeric proteins in:

    • Receptor binding assays to determine binding affinity changes

    • Cell proliferation assays to assess mitogenic activity

    • Differentiation assays to evaluate developmental signaling capacity

  • Structural validation: Confirm proper folding using circular dichroism spectroscopy and thermal stability assays.

Recent research on novel chimeric fibroblast growth factors has demonstrated their potential in regulating metabolism of various cell types, including fat and cancer cells . Similar approaches could identify which domains of gorilla FGF confer specific functional properties and how these might differ from human counterparts.

How might gorilla FGF contribute to understanding primate brain development?

Recombinant Gorilla gorilla gorilla Fibroblast growth factor offers valuable insights into primate brain development:

Recent research has demonstrated that certain growth factors, such as EPIREGULIN, are expressed in both human developing neocortex and gorilla cerebral organoids, but not in mouse neocortex . This suggests primate-specific roles for certain growth factors in brain development. Similar comparative studies with gorilla FGF could reveal whether it exhibits species-specific expression patterns or functions.

In experimental settings, addition of growth factors to developing mouse neocortex has been shown to increase proliferation of basal progenitor cells . Testing whether gorilla FGF produces similar effects, and whether these effects differ from those produced by human FGF, could help identify species-specific aspects of neurogenesis regulation.

Gorilla cerebral organoid models treated with various growth factors have revealed differential responses between primate species . For example, EPIREGULIN treatment promoted increased proliferation in gorilla but not human basal progenitor cells, suggesting species-specific sensitivity to certain growth factors. Similar comparative experiments with gorilla FGF would provide insights into the evolution of growth factor signaling in primate brain development.

What are the implications of gorilla FGF research for understanding metabolic regulation?

The study of Recombinant Gorilla gorilla gorilla Fibroblast growth factor has significant implications for metabolic research:

Fibroblast growth factors play crucial roles in metabolic regulation, and understanding primate-specific variations may provide insights into metabolic adaptations. Recent research initiatives, such as the AIMRC Team Science Supplement award, are exploring the potential of novel chimeric fibroblast growth factors to regulate metabolism in fat and cancer cells .

Dysregulated metabolism is considered a high-risk factor for cancer development, and growth factors like FGF can influence metabolic pathways. Comparative studies between human and gorilla FGF may reveal species-specific differences in metabolic regulation that could inform therapeutic approaches .

A multidisciplinary approach combining expertise in structural biology, FGF biology, adipose metabolism, protein synthesis, and advanced imaging techniques can provide comprehensive insights into how gorilla FGF influences metabolic processes . Such research could identify conserved versus divergent metabolic signaling pathways across primates.

What technical challenges must be overcome when designing long-term culture experiments with gorilla FGF?

Long-term culture experiments with Recombinant Gorilla gorilla gorilla Fibroblast growth factor present several technical challenges:

  • Protein stability: FGF proteins may degrade over time in culture conditions. Researchers should implement:

    • Regular supplementation schedules based on empirically determined half-life

    • Controlled-release delivery systems for consistent dosing

    • Stability monitoring via activity assays throughout experiment duration

  • Receptor desensitization: Prolonged exposure to growth factors can cause receptor downregulation. Strategies include:

    • Pulsatile treatment regimens to allow receptor recovery

    • Monitoring receptor expression levels throughout experiment

    • Co-administration of receptor trafficking modulators

  • Experimental controls: Long-term experiments require rigorous controls including:

    • Parallel cultures with heat-inactivated protein

    • Matched-concentration human FGF for species comparison

    • Receptor antagonist controls to confirm specificity

  • System complexity: For organoid or tissue culture systems:

    • Careful medium formulation to avoid interactions with other supplements

    • Consideration of stage-specific requirements during development

    • Three-dimensional imaging techniques for comprehensive phenotypic analysis

Careful consideration of these challenges is particularly important when studying developmental processes that occur over extended timeframes, such as neurogenesis in cerebral organoids .

What are the future research directions for gorilla FGF studies?

Future research involving Recombinant Gorilla gorilla gorilla Fibroblast growth factor should focus on:

  • Comprehensive comparative genomics to identify regulatory elements controlling FGF expression differences between primates. Recent studies have identified putative cis-regulatory elements that may contribute to observed inter-species differences in growth factor expression .

  • Development of more sophisticated primate-specific cell and organoid models that better recapitulate in vivo conditions for studying FGF signaling. The successful generation of gorilla-induced pluripotent stem cell (iPSC)-derived cerebral organoids demonstrates the feasibility of such approaches .

  • Integration of structural biology approaches to determine high-resolution structures of gorilla FGF and its complexes with receptors, potentially revealing subtle species-specific interaction differences.

  • Exploration of gorilla FGF in metabolic regulation and its potential implications for human health. Recent research initiatives examining the relationship between growth factors, metabolism, and disease susceptibility provide a framework for such investigations .

  • Development of chimeric or engineered FGF variants based on gorilla-specific sequences that may have enhanced therapeutic properties or specialized research applications.

These future directions will contribute to both fundamental understanding of primate evolution and potential applications in regenerative medicine and metabolic disease research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.