Recombinant Gorilla gorilla gorilla G-protein coupled receptor 56 (GPR56)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Gorilla gorilla gorilla G-protein coupled receptor 56

Recombinant Gorilla gorilla gorilla G-protein coupled receptor 56 (GPR56) is a laboratory-produced version of the naturally occurring G-protein coupled receptor found in Western lowland gorillas (Gorilla gorilla gorilla). This protein belongs to the broader family of G-protein coupled receptors (GPCRs), which function as integral membrane proteins with critical roles in cellular signal transduction. More specifically, GPR56 is formally designated as Adhesion G-protein coupled receptor G1 (ADGRG1) and categorized within the Class B2 (Adhesion) receptor family within the GPCR superfamily .

The production of recombinant GPR56 from Western lowland gorillas facilitates research into comparative receptor biology, evolutionary relationships among primates, and the fundamental mechanisms of GPCR signaling. By enabling the study of this receptor outside its native cellular environment, researchers can investigate its structural properties, binding characteristics, and potential applications in both basic science and biomedical research contexts.

Recombinant Forms and Production Methods

Commercial sources offer Recombinant Gorilla gorilla gorilla GPR56 in multiple forms to accommodate diverse research requirements. According to product specifications, these recombinant proteins are available in both full-length and partial constructs, with several expression systems employed for their production .

Table 1: Production Systems for Recombinant Gorilla gorilla gorilla GPR56

Expression SystemProtein FormPurity LevelPurification Method
Cell Free ExpressionFull-length≥85%SDS-PAGE verification
E. ColiPartial≥85%SDS-PAGE verification
YeastPartial≥85%SDS-PAGE verification
BaculovirusPartial≥85%SDS-PAGE verification
Mammalian CellPartial≥85%SDS-PAGE verification

All recombinant forms maintain a high purity standard of at least 85% as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analysis . The diverse expression systems allow researchers to select the most appropriate form based on their specific experimental requirements, with each system offering particular advantages in terms of post-translational modifications, folding, and functional properties.

Sequence Analysis and Protein Features

The amino acid sequence of GPR56 in Gorilla gorilla gorilla provides valuable insights into the functional domains and evolutionary conservation of this receptor. Based on the sequence data available in protein databases, GPR56 exhibits several distinct structural regions with specific functional implications .

The N-terminal region consists of approximately 389 amino acids and likely contains:

  • A signal peptide sequence (approximately the first 20 amino acids)

  • Potential glycosylation sites important for protein folding and stability

  • Domains involved in ligand recognition and binding

  • Regions that mediate protein-protein interactions with extracellular matrix components

The sequence data from position 390 onwards marks the beginning of the first transmembrane domain (TM1), which anchors the protein within the cell membrane . This transmembrane domain represents the first of seven such segments that collectively form the characteristic heptahelical structure of G-protein coupled receptors. These transmembrane regions play critical roles in conformational changes associated with receptor activation and signal transduction.

Applications in Comparative Biology Research

Recombinant Gorilla gorilla gorilla GPR56 serves as a valuable tool for investigations in comparative receptor biology, particularly across primate species. The availability of this recombinant protein enables several important research applications:

Evolutionary studies represent one of the primary applications, where researchers can compare the structure, function, and binding properties of GPR56 across different primate species. Such comparisons provide insights into the evolutionary history of this receptor family and help identify conserved regions that may be critical for fundamental receptor functions.

Structural biology investigations benefit significantly from access to purified recombinant GPR56. Techniques such as X-ray crystallography, nuclear magnetic resonance spectroscopy, and cryo-electron microscopy can be employed to determine the three-dimensional structure of the receptor, providing crucial information about ligand binding sites and conformational changes associated with receptor activation.

Signal transduction studies utilize recombinant GPR56 to investigate the specific intracellular pathways activated following receptor stimulation. These investigations help elucidate the cellular responses triggered by GPR56 activation and may reveal species-specific adaptations in signaling mechanisms.

Comparison with GPR56 in Other Species

The GPR56 receptor demonstrates remarkable conservation across primate species and other mammals, suggesting essential biological functions that have been maintained throughout evolutionary history. Comparative analysis of GPR56 from different species provides valuable insights into both conserved and species-specific features of this receptor.

Table 2: Comparative Analysis of GPR56 Across Species

SpeciesScientific NameAlternative DesignationsGene NamesNotable Features
Western lowland gorillaGorilla gorilla gorillaAdhesion G-protein coupled receptor G1GPR56, ADGRG1Subject of this article
ChimpanzeePan troglodytesG-protein coupled receptor 56GPR56, ADGRG1High sequence similarity to gorilla GPR56
Rhesus macaqueMacaca mulattaG-protein coupled receptor 56GPR56, ADGRG1Important model for primate research
OrangutanPongo pygmaeusG-protein coupled receptor 56GPR56Evolutionarily distinct great ape model
RatRattus norvegicusAdhesion G protein-coupled receptor G1Gpr56, Adgrg1Common rodent research model
MouseMus musculusAdhesion G protein-coupled receptor G1Gpr56, Adgrg1, Cyt28, TM7LN4, TM7XN1Well-characterized model organism

The availability of recombinant GPR56 from multiple species facilitates comparative structural and functional analyses. These studies help identify regions of the receptor that have been conserved across species due to their functional importance, as well as regions that exhibit species-specific variations potentially related to evolutionary adaptations .

Future Research Directions and Potential Applications

The continued investigation of Recombinant Gorilla gorilla gorilla GPR56 presents numerous opportunities for advancing our understanding of GPCR biology and primate evolution. Several promising directions for future research can be identified:

Comprehensive structural characterization represents a primary goal for future studies. While partial sequence information is available, complete three-dimensional structural determination would provide unprecedented insights into the receptor's mechanism of action and potential binding partners. Advanced structural biology techniques could reveal critical details about the spatial arrangement of the seven transmembrane domains and the conformation of the extensive N-terminal region.

Identification of natural ligands remains an important research objective. Determining the specific molecules that bind to and activate gorilla GPR56 would enhance our understanding of the receptor's physiological functions and potentially reveal species-specific adaptations in receptor-ligand interactions. Such discoveries might also have implications for comparative physiology and pharmacology.

Functional genomics approaches could help elucidate the expression patterns and regulatory mechanisms governing GPR56 in gorilla tissues. These investigations would complement structural and biochemical studies by providing a broader biological context for understanding the receptor's role in gorilla physiology.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ADGRG1; GPR56; Adhesion G-protein coupled receptor G1; G-protein coupled receptor 56
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-687
Protein Length
Full Length of Mature Protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
RGHREDFRFCSQRNQTHRSSLHYKPTADLRISIENSEEALTVHAPFPAARPASQSFPDPR GLYHFCLYWNRHAGRLHLLYGKHDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWS PQNVSLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPA RQQLQSLESKLTSVRFTGDTVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEILEY SVLLPRTLFQRTKGRRGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANL TEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYF AVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACIVTIAAYLCSRRKPRDYTIKVHMNLLL AVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLACLSWMGLEGYNLYRLVVEVFGTY VPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPSMCWIRDSLVSY ITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSFA SGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSS RI
Uniprot No.

Target Background

Function

GPR56 is a G-protein coupled receptor involved in cell adhesion and likely cell-cell interactions. It mediates cell-matrix adhesion in developing neurons and hematopoietic stem cells. In the developing brain, it acts as a receptor for collagen III (COL3A1), regulating cortical development by maintaining pial basement membrane integrity and cortical lamination. COL3A1 binding inhibits neuronal migration and activates the RhoA pathway via coupling to GNA13 and potentially GNA12. GPR56 plays a role in maintaining hematopoietic stem cells and/or leukemia stem cells within the bone marrow niche and is essential for testis development. Furthermore, it plays a critical role in tumorigenesis.

Protein Families
G-protein coupled receptor 2 family, LN-TM7 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.; [ADGRG1 N-terminal fragment]: Secreted.; [ADGRG1 C-terminal fragment]: Membrane raft.

Q&A

What is GPR56/ADGRG1 and what are its key structural features?

GPR56/ADGRG1 belongs to the adhesion G protein-coupled receptor family, characterized by a unique structural architecture. The protein contains an extracellular region (ECR) comprising a GPCR-Autoproteolysis-Inducing (GAIN) domain and a Pentraxin/Laminin/neurexin/sex-hormone-binding-globulin-Like (PLL) domain. The receptor undergoes autoproteolysis at the GPS (GPCR proteolysis site) within the GAIN domain, generating N-terminal (GPR56N) and C-terminal (GPR56C) fragments that remain non-covalently associated . The C-terminal fragment contains the characteristic seven-transmembrane domain typical of GPCRs, responsible for G protein coupling and downstream signaling .

For experimental designs involving GPR56, it's crucial to consider the autoproteolytic processing and the regulatory role of specific domains. The PLL domain, in particular, has been shown to have regulatory functions, as its deletion results in increased signaling activity .

What expression systems are most effective for producing recombinant Gorilla gorilla gorilla GPR56?

Several expression systems can be utilized for recombinant Gorilla gorilla gorilla GPR56 production, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical PurityBest Applications
Cell-free expressionRapid production, avoids cellular toxicityLimited post-translational modifications≥85% by SDS-PAGE Structural studies of isolated domains
E. coliHigh yield, cost-effectiveChallenging for full-length GPCRs, limited glycosylationVariableProduction of soluble domains
Yeast/BaculovirusModerate post-translational modificationsGlycosylation patterns differ from mammalian≥85% by SDS-PAGE Functional studies requiring some modifications
Mammalian cells (HEK293)Native-like post-translational modificationsLower yield, higher cost>80% by SDS-PAGE Signaling studies, interaction analyses

For structural and functional studies requiring properly folded protein with native-like modifications, mammalian expression systems (particularly HEK293 cells) are preferred . These systems provide appropriate glycosylation and ensure correct disulfide bond formation essential for maintaining the protein's native conformation.

What purification strategies yield the highest quality recombinant GPR56 protein?

Purification of high-quality recombinant Gorilla gorilla gorilla GPR56 requires a multi-step approach to ensure purity and functional integrity:

  • Affinity chromatography: Most recombinant GPR56 proteins incorporate affinity tags (commonly His-tags) enabling initial capture through nickel or cobalt affinity chromatography . This step typically achieves 85-90% purity.

  • Secondary purification: Following initial capture, size exclusion chromatography effectively separates monomeric GPR56 from aggregates and other contaminants, resulting in >95% purity for structural studies.

  • Quality control: Critical assessment methods include SDS-PAGE under reducing and non-reducing conditions, western blotting for identity confirmation, and dynamic light scattering to evaluate homogeneity .

For membrane-associated GPR56 constructs, careful selection of detergents is essential, with mild non-ionic detergents (DDM, LMNG) generally proving effective for maintaining functional integrity. Researchers should implement appropriate protease inhibitors throughout purification to prevent degradation.

How conserved is GPR56 across different primate species including Gorilla gorilla gorilla?

GPR56 shows significant evolutionary conservation across primate species, reflecting its essential roles in central nervous system development. Sequence analysis reveals:

The high conservation of functional domains, particularly the GAIN domain and the seven-transmembrane region, indicates the critical importance of GPR56 function throughout primate evolution . The PLL domain, which contains evolutionarily conserved residues critical for oligodendrocyte development, shows particularly strong conservation across primate species .

For experimental design, these conservation patterns suggest that functional mechanisms established in human GPR56 likely apply to the gorilla ortholog, though species-specific variations may modulate signaling efficiency or ligand interactions.

How do alternative splice variants of GPR56 affect its signaling properties?

GPR56 undergoes alternative splicing that significantly impacts its signaling capabilities. A critical finding is that deletion of the PLL domain, characteristic of one GPR56 splice variant, results in increased signaling activity . This suggests the PLL domain has an autoinhibitory function in the full-length receptor.

For experimental investigations of Gorilla gorilla gorilla GPR56 splice variants:

  • Identify predominant splice variants using RNA-seq analysis of relevant gorilla tissues.

  • Generate recombinant constructs of major splice variants for comparative functional studies.

  • Assess differences in:

    • Basal activity (G protein activation in absence of ligand)

    • Ligand-induced signaling (EC50 values and maximal responses)

    • Receptor trafficking and cell surface expression

    • Interaction with regulatory proteins

When designing these experiments, it's essential to maintain consistent expression levels across variants and use appropriate controls (non-spliced variants, signaling-deficient mutants) for valid comparisons.

What are the optimal experimental conditions for analyzing GPR56 activation in vitro?

Establishing optimal conditions for analyzing recombinant Gorilla gorilla gorilla GPR56 activation requires careful optimization of multiple parameters:

ParameterRecommended ConditionsConsiderations
Cell systemHEK293 cells lacking endogenous GPR56Ensure equivalent expression levels across constructs
Buffer compositionpH 7.4, 150 mM NaCl, 1-2 mM CaCl₂, 1 mM MgCl₂Divalent cations important for receptor conformation
Activation assaysG protein coupling (BRET/FRET), ERK phosphorylation, β-arrestin recruitmentMultiple readouts provide comprehensive activation profile
Positive controlsConstitutively active mutants, synthetic peptide agonistsEstablish maximum signaling capacity
Negative controlsSignaling-deficient mutants, inverse agonists (e.g., monobodies)Establish baseline activity

For G protein coupling assays, BRET-based approaches offer high sensitivity for detecting activation-dependent conformational changes. When comparing gorilla GPR56 to human orthologs, maintain identical experimental conditions and expression levels to identify genuine species-specific differences in activation mechanisms .

How can I design experiments to investigate the role of GPR56 in oligodendrocyte development?

GPR56 plays critical roles in oligodendrocyte development and myelination, as indicated by white matter abnormalities in BFPP patients . To investigate these functions using recombinant Gorilla gorilla gorilla GPR56:

  • Comparative expression analysis:

    • Analyze GPR56 expression patterns in oligodendrocyte lineage cells across primate species

    • Determine temporal regulation during development

    • Identify species-specific splice variant distribution

  • Functional domain analysis:

    • Generate constructs with mutations in evolutionarily conserved residues of the PLL domain

    • Create domain-swap chimeras between human and gorilla GPR56

    • Test impacts on oligodendrocyte differentiation and myelination

  • Signaling pathway characterization:

    • Map downstream signaling cascades using phosphoproteomic approaches

    • Identify G protein coupling preferences and dynamics

    • Determine effects on transcription factors regulating oligodendrocyte differentiation

A particularly informative approach involves introducing GPR56 variants into oligodendrocyte precursor cells (OPCs) and assessing their effects on differentiation, process extension, and myelin protein expression. This can be accomplished through lentiviral transduction followed by immunostaining for stage-specific markers (PDGFRα, O4, MBP) .

What experimental approaches can identify novel binding partners for gorilla GPR56?

Identifying novel binding partners for Gorilla gorilla gorilla GPR56 requires a multi-faceted strategy combining complementary techniques:

ApproachMethodologyAdvantagesConsiderations
Affinity purification-mass spectrometryExpress tagged GPR56, purify complexes, identify by LC-MS/MSComprehensive interactome analysisMay miss transient interactions
Proximity labeling (BioID, APEX2)Fuse GPR56 to biotin ligase to label proximal proteinsCaptures transient interactions in native environmentRequires optimization of labeling conditions
Protein microarray screeningScreen purified GPR56 against arrays of potential partnersHigh-throughput identification of direct interactionsLimited to proteins represented on arrays
Crosslinking mass spectrometryStabilize interactions with crosslinkers, analyze by MSMaps interaction interfaces at amino acid resolutionComplex data analysis, potential artifacts

When analyzing potential binding partners, prioritize extracellular matrix components (collagen III has been implicated for human GPR56), cell adhesion molecules, and secreted factors relevant to oligodendrocyte development . Validation of identified interactions should include co-immunoprecipitation experiments, surface plasmon resonance for affinity determination, and functional assays to establish biological relevance.

How do I design experiments to compare signaling between human and gorilla GPR56?

To systematically compare signaling properties between human and Gorilla gorilla gorilla GPR56:

  • Construct design and expression:

    • Generate full-length constructs with identical tags/fusion partners

    • Ensure equivalent expression levels in the same cell background

    • Include domain-swap chimeras to map species-specific differences

  • G protein coupling analysis:

    • Use BRET/FRET biosensors to measure coupling efficiency to different G protein subtypes

    • Determine activation kinetics and dose-response relationships

    • Compare basal activity and maximal stimulation

  • Downstream signaling comparison:

    • Perform phosphoproteomic analysis following receptor activation

    • Compare activation of key pathways (MAPK/ERK, cAMP, Ca²⁺ signaling)

    • Analyze transcriptional responses using RNA-seq

  • Functional consequences:

    • Assess effects on cell proliferation, migration, and differentiation

    • Compare ECM adhesion properties

    • Evaluate impacts on myelination in co-culture systems

This comparative approach can reveal evolutionary adaptations in GPR56 signaling that may relate to species-specific aspects of brain development and myelination patterns .

What are the key considerations for structural studies of recombinant GPR56?

Structural studies of recombinant Gorilla gorilla gorilla GPR56 present specific challenges requiring careful methodological consideration:

  • Construct design is critical:

    • For X-ray crystallography, consider separate domains (ECR, PLL, GAIN) rather than full-length protein

    • Include stabilizing binding partners (such as monobodies, which have been successfully used as inverse agonists for human GPR56)

    • Incorporate strategic mutations to remove flexible regions while preserving function

  • Expression and purification optimization:

    • Mammalian expression systems provide appropriate post-translational modifications

    • For membrane domains, screen multiple detergents to identify optimal solubilization conditions

    • Ensure protein homogeneity through rigorous size-exclusion chromatography

  • Structural determination approaches:

    • X-ray crystallography works well for isolated domains (as demonstrated for human GPR56 ECR)

    • Cryo-EM is increasingly viable for full-length GPCRs, especially with antibody fragments

    • NMR spectroscopy can provide dynamic information for smaller domains

The successful determination of the human GPR56 ECR crystal structure in complex with an inverse-agonist monobody provides a valuable template for comparative structural studies with the gorilla ortholog.

How can I study the effects of disease-associated mutations in gorilla GPR56?

Mutations in human GPR56 cause bilateral frontoparietal polymicrogyria (BFPP), a brain malformation characterized by cortical disorganization and myelination defects . To study equivalent mutations in Gorilla gorilla gorilla GPR56:

  • Design an experimental panel that includes:

    • Wild-type gorilla GPR56 as baseline

    • Human wild-type GPR56 for cross-species comparison

    • Gorilla GPR56 with mutations equivalent to human BFPP-causing variants

    • Control mutations in non-critical regions

  • Structural and functional characterization:

    • Assess protein expression, folding, and autoproteolysis status

    • Evaluate cell surface trafficking using flow cytometry

    • Determine ligand binding properties

    • Measure G protein coupling efficiency and downstream signaling

  • Developmental impact assessment:

    • Test effects on neural cell migration in vitro

    • Evaluate oligodendrocyte differentiation and myelination

    • Analyze impacts on extracellular matrix interactions

When interpreting results, focus on identifying conserved disease mechanisms versus species-specific responses, which may provide insights into why certain mutations cause severe phenotypes in humans.

How do post-translational modifications affect gorilla GPR56 function?

Post-translational modifications (PTMs) significantly influence GPR56 function, affecting ligand binding, signaling efficiency, and receptor trafficking:

Modification TypeKey SitesFunctional ImpactPreservation Strategy
N-linked glycosylationMultiple sites in ECRAffects folding, trafficking, ligand bindingUse mammalian expression systems
AutoproteolysisGPS motif in GAIN domainEssential for proper receptor functionMaintain native GPS sequence, verify processing
PhosphorylationC-terminal region, intracellular loopsRegulates signaling and internalizationInclude phosphatase inhibitors during purification
Disulfide bondsECR domainMaintain tertiary structureAvoid strong reducing agents during purification

For comprehensive PTM characterization, mass spectrometry (LC-MS/MS) should be employed to map modification sites. When comparing human and gorilla GPR56, focus on conserved versus species-specific PTM sites, which may reflect evolutionary adaptations in receptor regulation .

To preserve PTMs in recombinant proteins, mammalian expression systems (particularly HEK293 cells) are strongly recommended over prokaryotic systems. During purification, use mild conditions that maintain modification integrity, including appropriate protease and phosphatase inhibitors.

What are the best approaches for functional validation of GPR56 in relevant cell types?

To validate the function of recombinant Gorilla gorilla gorilla GPR56 in physiologically relevant contexts:

  • Cell system selection:

    • Primary oligodendrocyte precursor cells for myelination studies

    • Neural progenitor cells for migration and cortical development assays

    • Cell lines stably expressing GPR56 for mechanistic studies

  • Gene manipulation approaches:

    • CRISPR/Cas9 for precise genome editing

    • Lentiviral transduction for stable expression

    • Rescue experiments in GPR56-knockout backgrounds

  • Functional readouts:

    • Oligodendrocyte differentiation: morphology changes, myelin gene expression

    • Migration assays: wound healing, transwell migration

    • Signaling: pathway-specific phosphorylation, transcriptional changes

    • Cell-ECM interactions: adhesion strength, matrix reorganization

  • Validation controls:

    • Species-matched wild-type GPR56

    • Known function-disrupting mutations

    • Domain deletion variants with established phenotypes

These approaches allow for rigorous validation of GPR56 function in contexts relevant to its known roles in brain development and myelination .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.