Recombinant Gorilla gorilla gorilla Histamine H2 receptor (HRH2)

Shipped with Ice Packs
In Stock

Description

Functional Role and Mechanism

HRH2 activation by histamine triggers adenylate cyclase via Gαs coupling, elevating intracellular cAMP levels. This pathway regulates:

  • Gastric Acid Secretion: Primary target for anti-ulcer drugs like H2 antagonists .

  • Smooth Muscle Relaxation: Vasodilation via protein kinase A (PKA)-mediated phosphorylation .

  • Immune Modulation: Suppression of neutrophil activation and cytokine production .

In gorillas, HRH2 may also contribute to unique physiological traits, such as variations in gastrointestinal motility or energy metabolism . Structural comparisons with human HRH2 highlight evolutionary divergence in regions linked to cell signaling .

3.1. Recombinant Production

  • Expression System: E. coli .

  • Purification: Affinity chromatography using His tag .

  • Reconstitution: Solubilized in sterile water or glycerol-containing buffers for long-term storage .

3.2. Research Applications

ApplicationUse Case
Drug DevelopmentScreening H2 receptor antagonists for gastrointestinal therapies .
Comparative GenomicsStudying evolutionary divergence in GPCR signaling pathways .
Structural BiologyMapping ligand-binding sites using mutagenesis or cryo-EM .
ImmunoassaysTarget protein in ELISA and Western blot for antibody validation .

Comparative Insights from Gorilla-Specific Studies

  • Chromosomal Translocation: The HRH2 gene in gorillas is located on a rearranged chromosome resulting from a translocation between ancestral chromosomes homologous to human chromosomes 5 and 17 .

  • Transcript Variants: RNA sequencing identified gorilla-specific exons in the HRH2 transcript, leading to a 134-amino-acid extension in the protein compared to humans . This structural divergence may affect receptor dimerization or ligand specificity.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development with the specified tag.
Synonyms
HRH2; Histamine H2 receptor; H2R; HH2R; Gastric receptor I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Uniprot No.

Target Background

Function
The H2 subclass of histamine receptors mediates gastric acid secretion. It also appears to regulate gastrointestinal motility and intestinal secretion. A possible role in regulating cell growth and differentiation has also been observed. The activity of this receptor is mediated by G proteins that activate adenylyl cyclase and, through a separate G protein-dependent mechanism, the phosphoinositide/protein kinase (PKC) signaling pathway.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Gorilla gorilla gorilla Histamine H2 receptor?

The Gorilla gorilla gorilla Histamine H2 receptor (HRH2) is a 359-amino acid protein with a molecular weight of approximately 40 kDa, similar to human H2R. The receptor is a G protein-coupled receptor (GPCR) with seven transmembrane domains. The complete amino acid sequence is available and includes multiple functional domains responsible for ligand binding and signal transduction. The protein shares significant structural homology with H2 receptors from other species, suggesting evolutionary conservation of this important signaling molecule .

How does the amino acid sequence of Gorilla gorilla gorilla HRH2 compare to human H2R?

The Gorilla gorilla gorilla HRH2 exhibits high sequence homology with human H2R. While the exact percentage isn't specified in the available data, research indicates that H2Rs generally show 83-95% identity across species including human, guinea pig, mouse, rat, and dog . The conservation is particularly strong in the transmembrane regions and binding domains. The gorilla HRH2 has the UniProt accession number Q76MS7, and its full amino acid sequence (359 residues) shows the characteristic structural features of histamine receptors .

What are the key functional domains of Gorilla gorilla gorilla HRH2?

Like other H2 receptors, the Gorilla gorilla gorilla HRH2 contains several critical functional domains. Research on H2Rs indicates that the COOH terminus plays a significant role in agonist-induced internalization, though the specific protein-protein interactions remain incompletely characterized . The receptor likely contains histamine binding domains in the transmembrane regions, G-protein coupling domains in the intracellular loops, and regulatory domains that control receptor activity and trafficking. The extracellular domains contribute to ligand recognition while the intracellular components mediate downstream signaling cascades .

What are optimal storage conditions for recombinant Gorilla gorilla gorilla HRH2 proteins?

For optimal retention of biological activity, recombinant Gorilla gorilla gorilla HRH2 proteins should be stored at -20°C for regular use, or at -80°C for extended storage. The protein is typically supplied in a Tris-based buffer containing 50% glycerol specifically optimized for this protein's stability. It is crucial to note that repeated freezing and thawing cycles significantly reduce protein activity and should be avoided. For ongoing experiments, working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw cycles .

How should researchers design experiments to study HRH2 signaling pathways?

When designing experiments to investigate HRH2 signaling pathways, researchers should consider the receptor's dual coupling ability to different G protein families. Based on histamine receptor research, H2R activates both adenylyl cyclase (through Gs) and phospholipase C (through Gq family members) . A comprehensive experimental design would include:

Signaling PathwayMeasured ParameterDetection MethodControls
Gs-mediatedcAMP formationELISA/FRET-based assaysBaseline, H2R antagonist (e.g., ranitidine)
Gq-mediatedCa²⁺ mobilizationFluorescent Ca²⁺ indicatorsBaseline, PLC inhibitor
Downstream effectorsGene expressionqPCR/Western blotTime course, pathway inhibitors

Researchers should include appropriate positive controls (histamine stimulation) and negative controls (receptor antagonists) to confirm pathway specificity. Concentration-response studies with varying histamine concentrations will provide valuable information about receptor sensitivity and signaling dynamics .

What expression systems are recommended for functional studies of recombinant Gorilla gorilla gorilla HRH2?

Based on successful approaches with histamine receptors, several expression systems can be employed. Insect cell lines (like Sf9) infected with baculovirus encoding HRH2 have been effectively used for histamine receptor studies and provide a robust system for functional expression . Mammalian cell lines such as COS cells transfected with HRH2 cDNA are also suitable, particularly for studies involving mammalian G protein coupling. These systems allow for concentration-dependent measurement of receptor activation through cAMP accumulation and inositol phosphate production. When selecting an expression system, researchers should consider the specific research questions, as different systems may favor distinct aspects of receptor function or regulation .

How can researchers investigate G protein coupling specificity of Gorilla gorilla gorilla HRH2?

To investigate G protein coupling specificity of Gorilla gorilla gorilla HRH2, researchers can employ multiple complementary approaches. One powerful method involves labeling activated G proteins with [α-³²P]GTP azidoanilide followed by selective immunoprecipitation to identify which G protein α-subunits couple with the activated receptor . Additionally, co-transfection experiments where HRH2 is expressed alongside various G protein α-subunits (such as αq, α11, α14, α15, α12, or αs) can reveal which G proteins enhance receptor-stimulated signaling. The concentration-dependent accumulation of second messengers (cAMP for Gs coupling and inositol phosphates for Gq coupling) provides functional readouts for these interactions. Pertussis toxin sensitivity tests can help distinguish between Gi/Go and other G protein families involved in receptor signaling .

What methods are suitable for studying constitutive activity of Gorilla gorilla gorilla HRH2?

Studying constitutive activity of HRH2 requires experimental designs that can detect receptor activity in the absence of agonist stimulation. H2Rs exhibit constitutive activity that can be regulated by inverse agonists . Researchers should:

  • Measure basal signaling (cAMP and inositol phosphate levels) in cells expressing HRH2 compared to non-transfected controls

  • Evaluate the effects of known H2R inverse agonists on baseline signaling

  • Study receptor upregulation phenomena that occur after prolonged exposure to inverse agonists

  • Compare constitutive activity levels across different expression systems and receptor densities

  • Create mutant receptors with predicted alterations in constitutive activity

These approaches help characterize the intrinsic signaling properties of HRH2 and can reveal important regulatory mechanisms that may have physiological or therapeutic relevance .

How can researchers explore the role of COOH terminus in HRH2 internalization?

To investigate the role of the COOH terminus in HRH2 internalization, researchers should design experiments that specifically target this domain. Since the COOH terminus plays a known role in agonist-induced internalization of H2R , the following methodological approaches are recommended:

  • Create truncated receptor variants with progressive deletions of the COOH terminal region

  • Generate point mutations at potential phosphorylation sites within the COOH terminus

  • Develop fusion proteins with fluorescent tags to visualize trafficking in real-time

  • Employ immunofluorescence microscopy to track receptor localization before and after agonist stimulation

  • Use co-immunoprecipitation to identify proteins that interact with the COOH terminus during internalization

Results from these experiments can be quantified by measuring surface receptor expression, internalization rates, and recycling dynamics following agonist exposure across different receptor variants .

How should concentration-response data for HRH2 activation be analyzed and presented?

Concentration-response data for HRH2 activation should be systematically organized and presented according to scientific standards. When creating data tables, the independent variable (histamine or other ligand concentration) should be placed in the left column, with the dependent variables (receptor activation measurements) in subsequent columns, including separate columns for different trials and calculated averages . A properly formatted data table would look like:

Histamine Concentration (M)cAMP Production Trial 1 (pmol/mg)cAMP Production Trial 2 (pmol/mg)cAMP Production Trial 3 (pmol/mg)Average cAMP Production (pmol/mg)
10⁻⁹2.32.12.52.3
10⁻⁸5.76.25.95.9
10⁻⁷14.215.013.914.4
10⁻⁶32.533.132.832.8
10⁻⁵45.346.144.845.4

Data should be analyzed by fitting to appropriate mathematical models (e.g., four-parameter logistic equation) to determine EC₅₀ values and efficacy parameters. Both tabular and graphical presentations should include clear titles, proper labeling of axes, and appropriate units .

What statistical approaches are appropriate for analyzing HRH2 dual signaling pathways?

When analyzing the dual signaling pathways of HRH2 (adenylyl cyclase and phospholipase C) , researchers should employ statistical methods that account for the complexity of bifurcating signals. Appropriate approaches include:

  • Two-way ANOVA to examine interactions between pathway activation and experimental conditions

  • Correlation analyses to investigate relationships between cAMP and calcium responses

  • Multivariate analyses when measuring multiple downstream effectors

  • Non-linear regression for concentration-response curves to determine EC₅₀ values for each pathway

  • Time-course analyses to compare kinetics of different signaling events

When presenting statistical results, researchers should clearly state the specific tests used, p-values obtained, and include appropriate measures of central tendency and dispersion. For dual pathway experiments, parallel analyses of both signaling branches allow for direct comparison of sensitivity, efficacy, and temporal dynamics .

How can researchers interpret contradictory results when studying HRH2 function across different experimental systems?

When encountering contradictory results across different experimental systems, researchers should consider several potential sources of variability. The H2R has been shown to couple to different G proteins depending on the cellular context and expression system . To resolve contradictions:

  • Compare expression levels of the receptor and signaling components across systems

  • Evaluate the presence of endogenous regulators that may differ between cell types

  • Consider post-translational modifications that might vary between expression systems

  • Examine the potential for receptor heterodimerization with other GPCRs

  • Test whether differences in receptor trafficking or membrane localization contribute to functional variations

Validation across multiple experimental systems is essential, and researchers should systematically rule out technical artifacts before concluding that contradictions represent genuine biological differences in receptor function .

What evolutionary insights can be gained from studying primate histamine receptors?

Studying primate histamine receptors, including Gorilla gorilla gorilla HRH2, provides valuable evolutionary insights into receptor structure-function relationships and physiological adaptations. Since H2Rs exhibit strong sequence homology across species , comparing the subtle differences between primate H2Rs could reveal evolutionary pressures that shaped histaminergic signaling in different lineages. These studies might identify species-specific amino acid substitutions that correlate with differences in diet, environment, or physiology. For example, adaptations in gastric H2R function might reflect different dietary patterns, while modifications in neuronal H2Rs could correspond to species-specific behavioral or cognitive adaptations. Comparative analyses of constitutive activity, ligand recognition, and signaling efficiency across primates could highlight functionally important receptor domains that have been conserved or modified throughout evolutionary history .

How can researchers design cross-species comparative studies of histamine receptor pharmacology?

To design effective cross-species comparative studies of histamine receptor pharmacology, researchers should use standardized methodologies that minimize system-specific variables. Based on approaches used in histamine receptor research , a robust experimental design would:

  • Express receptors from different species (including Gorilla gorilla gorilla HRH2) in the same cell system to control for cellular factors

  • Use identical experimental conditions and assay methodologies across species comparisons

  • Conduct parallel concentration-response studies with a panel of agonists and antagonists

  • Employ radioligand binding assays to determine affinity constants independent of signaling readouts

  • Compare G protein coupling specificity using [α-³²P]GTP azidoanilide labeling or co-transfection approaches

  • Analyze receptor internalization and desensitization kinetics across species

Data from these experiments should be organized in comparative tables that facilitate direct comparison of pharmacological parameters (EC₅₀, K_i, E_max values) across species. This approach allows for identification of species-specific pharmacological properties that may have translational implications for drug development and understanding of physiological differences .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.