Recombinant Gorilla gorilla gorilla Muscarinic acetylcholine receptor M3 (CHRM3)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

Production System

  • Host: Escherichia coli (E. coli)

  • Storage: -20°C for short-term; -80°C for long-term storage

  • Purity: >90% confirmed via SDS-PAGE

  • Buffer: Tris/PBS-based with 6% trehalose (pH 8.0)

Critical Notes

  • Avoid repeated freeze-thaw cycles to maintain stability .

  • Working aliquots stored at 4°C retain functionality for up to one week .

Functional Insights

Mechanism of Action

  • Binds acetylcholine to activate Gq/11 proteins, triggering phosphatidylinositol hydrolysis and intracellular calcium release .

  • Regulates smooth muscle contraction (e.g., bronchial, gastrointestinal) and glandular secretion .

Pathophysiological Relevance

  • Mutations linked to Eagle-Barrett syndrome (prune belly syndrome), characterized by urinary tract abnormalities and megacystis .

  • Targeted by bronchodilators like tiotropium in respiratory diseases .

Research Applications

Key Studies

  • Structural Dynamics: Cryo-EM and molecular dynamics simulations reveal transient allosteric binding of tiotropium in rat M3 receptors, aiding ligand design .

  • Antibody Development: Polyclonal antibodies (e.g., ABIN674484) validated for ELISA, Western blot, and immunohistochemistry in human, mouse, and rat tissues .

  • Hematopoietic Research: Antagonists enhance erythroid progenitor self-renewal via cAMP/CREB signaling, suggesting therapeutic potential for anemias .

Comparative Analysis

Cross-Species Homology

SpeciesUniProt IDSequence Identity vs. Gorilla CHRM3Key Functional Domains Conserved
Human (Homo sapiens)P20309 98.7%Ligand binding, Gq coupling
Rat (Rattus norvegicus)NP_11224394.2%Transmembrane helices 1-7
Chimpanzee (Pan troglodytes)Q9N2A4 99.8%Extracellular loop 2

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
CHRM3; Muscarinic acetylcholine receptor M3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-590
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTDTHFGSYNVSRAAGNFSSPDGTTDDPL GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN PVCYALCNKTFRTTFKMLLLCQCGKKKRRKQQYQQRQSVIFHKRAPEQAL
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through the action of G proteins. The primary transducing effect is Pi turnover.
Database Links
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the Muscarinic Acetylcholine Receptor M3 (CHRM3) and what are its primary functions?

The Muscarinic Acetylcholine Receptor M3 (CHRM3) is a G protein-coupled receptor that belongs to the family of muscarinic acetylcholine receptors, which are activated by the neurotransmitter acetylcholine. Based on studies in mice, CHRM3 plays crucial physiological roles in multiple peripheral autonomic functions, particularly in salivary secretion, pupillary constriction, and bladder detrusor contractions. Knockout studies in mice have demonstrated that while other muscarinic receptor subtypes (M1, M2, and M4) appear to function primarily in the central nervous system, the M3 receptor is essential for peripheral cholinergic systems. The receptor's signaling pathways typically involve coupling to Gq proteins, leading to increased phosphoinositide hydrolysis and subsequent calcium mobilization, which ultimately mediates smooth muscle contraction and glandular secretion .

How does gorilla CHRM3 differ structurally from human CHRM3?

While the search results don't provide specific data on Gorilla gorilla gorilla CHRM3, researchers should approach this comparison through sequence alignment and structural analysis. The CHRM3 gene is generally well-conserved across primates, but species-specific variations may exist in regulatory regions, binding domains, or post-translational modification sites. When analyzing differences, researchers should focus on amino acid substitutions in the transmembrane domains, ligand-binding pockets, and intracellular loops involved in G-protein coupling. These structural variations may contribute to subtle differences in ligand binding affinity, signaling efficiency, or regulatory mechanisms. Comparative studies would require expression of both human and gorilla CHRM3 variants under identical conditions to accurately assess functional differences.

What expression systems are most appropriate for recombinant gorilla CHRM3?

For recombinant expression of gorilla CHRM3, researchers should consider several expression systems based on experimental objectives. Mammalian cell systems (HEK293, CHO cells) provide the most physiologically relevant post-translational modifications and membrane composition, particularly important for receptor trafficking and function. Insect cell systems (Sf9, High Five) offer high yield but different glycosylation patterns. For structural studies requiring large protein quantities, yeast systems (Pichia pastoris) may be suitable, though membrane protein expression can be challenging. When selecting an expression system, consider the intended experimental applications (functional studies, structural analyses, protein-protein interactions) and the need for native-like receptor conformation. For functional studies comparing gorilla and human CHRM3, identical expression systems should be used to minimize system-dependent variables.

How should experiments be designed to compare functional differences between gorilla and human CHRM3 receptors?

Designing robust comparative experiments requires careful consideration of multiple factors. Begin with codon-optimized constructs for both gorilla and human CHRM3, ensuring identical vector elements (promoters, tags) to normalize expression levels. Expression should be validated through qRT-PCR and Western blotting with careful quantification. For functional comparisons, implement a multi-parameter approach including: (1) radioligand binding assays with various agonists and antagonists to determine binding affinities (Kd) and receptor densities (Bmax); (2) calcium mobilization assays using fluorescent indicators like Fura-2 to measure signaling dynamics; (3) MAPK/ERK phosphorylation assays to assess downstream signaling; and (4) receptor internalization studies using fluorescently-tagged receptors. Additionally, perform dose-response experiments across a range of agonist concentrations to generate complete pharmacological profiles. Controls should include selective antagonists to confirm receptor specificity and cells expressing unrelated GPCRs to control for non-specific effects .

What approaches are recommended for studying the physiological roles of gorilla CHRM3 through transgenic animal models?

Creating transgenic models to study gorilla CHRM3 physiological functions requires careful consideration of regulatory and methodological factors. The appropriate model choice depends on research questions - humanized mice (replacing mouse Chrm3 with gorilla CHRM3) are suitable for basic receptor function studies, while conditional knockout models with gorilla CHRM3 rescue allow tissue-specific investigations. Generate founder lines using CRISPR/Cas9 technology rather than traditional homologous recombination for improved efficiency. For proper regulatory compliance, all transgenic rodent creation falls under specific NIH Guidelines: BL1 containment experiments under Section III-E-3 and higher containment levels under Section III-D-4 . Validate successful genomic integration using Southern blotting, confirm expression with RT-PCR and Western blotting, and verify receptor functionality through ligand binding assays. When designing experiments, include appropriate controls: wild-type littermates, human CHRM3 transgenic animals, and possibly M3 knockout models. This comprehensive approach allows for meaningful comparative analysis of gorilla CHRM3 function in vivo.

How can researchers distinguish between direct CHRM3 effects and compensatory mechanisms in knockout/transgenic models?

Distinguishing direct CHRM3 effects from compensatory mechanisms represents a significant challenge in receptor biology research. To address this complexity, implement a multi-faceted approach. First, develop conditional knockout/knockin systems using Cre-loxP technology, which allows temporal control of gorilla CHRM3 expression, minimizing developmental compensation. Second, perform comprehensive transcriptomic and proteomic analyses comparing wild-type, knockout, and gorilla CHRM3-expressing tissues at multiple timepoints to identify compensatory changes in related receptors (particularly other muscarinic receptor subtypes) and downstream signaling components. Third, use acute pharmacological interventions with selective CHRM3 antagonists alongside genetic models to differentiate between immediate receptor blockade effects and long-term adaptive responses. Fourth, examine potential compensatory mechanisms through targeted analysis of other cholinergic receptors (nicotinic acetylcholine receptors) and non-cholinergic systems that might assume CHRM3 functions. Finally, employ tissue-specific knockout models to isolate effects in specific organs known to express high levels of CHRM3, similar to the salivary glands, eyes, and bladder tissue findings in the mouse studies .

What are the optimal protocols for isolating and purifying recombinant gorilla CHRM3 for structural studies?

Purification of recombinant gorilla CHRM3 for structural studies presents significant challenges due to its membrane protein nature. Begin with an optimized expression system, preferably insect cells (Sf9) with a baculovirus vector containing a TEV-cleavable affinity tag (His10 or FLAG) and a stability-enhancing fusion partner (T4 lysozyme or BRIL) inserted into the third intracellular loop. For solubilization, screen detergents systematically, testing DDM, LMNG, GDN, and digitonin, with focus on maintaining ligand binding activity. Implement a two-step purification: initial IMAC (immobilized metal affinity chromatography) followed by size exclusion chromatography. Critical quality control checkpoints include monodispersity assessment via SEC-MALS, ligand binding validation through microscale thermophoresis, and protein stability evaluation using differential scanning fluorimetry. For crystallography, lipidic cubic phase crystallization with specific ligands (typically antagonists) will stabilize the receptor. Alternatively, for cryo-EM studies, reconstitute purified receptor into nanodiscs or amphipols to better mimic the native membrane environment. Throughout the purification process, maintain conditions that preserve receptor stability (appropriate pH, presence of stabilizing ligands, and cholesterol supplementation).

What techniques are most effective for comparative analysis of ligand binding properties between gorilla and human CHRM3?

For rigorous comparative analysis of ligand binding properties between gorilla and human CHRM3, researchers should employ multiple complementary techniques. Saturation binding assays using radiolabeled antagonists (such as [³H]-N-methylscopolamine) provide fundamental binding parameters (Kd, Bmax) that quantify affinity and expression levels. Competition binding assays with a panel of muscarinic ligands, including both orthosteric and allosteric compounds, generate comprehensive pharmacological profiles (Ki values). Binding kinetics (kon, koff) should be determined through association and dissociation experiments to reveal potential species differences in binding mechanisms. For higher-throughput analysis, implement fluorescence-based approaches such as FRET or BRET assays using tagged receptors and ligands. Structural insights can be gained through computational methods including homology modeling and molecular docking, which predict binding pocket conformations and ligand interactions. All comparative experiments must be conducted with matched expression levels and identical experimental conditions, using multiple independent biological replicates. Statistical analysis should include appropriate tests for significance of observed differences and calculation of 95% confidence intervals for all determined parameters.

How should researchers approach the development of selective tools to study gorilla CHRM3 function?

Developing selective tools for gorilla CHRM3 research requires a systematic approach spanning multiple scientific disciplines. Begin with computational methods to identify unique structural features of gorilla CHRM3 compared to human CHRM3 and other muscarinic subtypes through homology modeling and molecular dynamics simulations. These differences can guide the rational design of selective ligands or antibodies. For antibody development, generate monoclonal antibodies against specific extracellular regions of gorilla CHRM3, carefully screening for cross-reactivity with human CHRM3 and other muscarinic subtypes. For genetic tools, design specific siRNAs or CRISPR guides targeting unique regions of gorilla CHRM3 mRNA, validating specificity through comprehensive off-target analysis. Develop fluorescent or bioluminescent biosensors by fusing appropriate sensors to the receptor or its downstream effectors to monitor activation in real-time. Pharmacological tools should include both orthosteric and allosteric modulators, with structure-activity relationship studies to enhance selectivity for gorilla CHRM3. All tools must undergo rigorous validation in multiple systems, including binding/functional assays and the appropriate cellular contexts, with comprehensive documentation of selectivity profiles across related receptors.

What NIH Guidelines apply to research involving recombinant gorilla CHRM3?

Research involving recombinant gorilla CHRM3 must adhere to specific regulatory frameworks established by the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. For experiments involving in vitro expression of gorilla CHRM3 in prokaryotic or eukaryotic cells, work likely falls under Section III-E, requiring Institutional Biosafety Committee (IBC) review and approval before initiation, with BL1 containment typically sufficient. For the generation of transgenic animals expressing gorilla CHRM3, the applicable guidelines depend on the animal model and containment requirements. Specifically, transgenic rodent development that can be housed at BL1 falls under Section III-E-3, while those requiring higher containment levels (BL2, BL3, or BL4) are covered by Section III-D-4 . For non-rodent transgenic animals expressing gorilla CHRM3, Section III-D-4 applies regardless of containment level. Researchers must maintain comprehensive documentation including experimental protocols, safety assessments, and animal tracking records. Additionally, any breeding of transgenic lines to create novel combinations (such as crossing different receptor variant lines) requires separate IBC approval unless specifically exempted under Appendix C-VIII .

What biosafety considerations should be addressed when working with recombinant gorilla CHRM3?

When working with recombinant gorilla CHRM3, biosafety considerations should address both standard recombinant DNA practices and specific receptor-related concerns. For laboratory containment, most work with gorilla CHRM3 can be conducted at Biosafety Level 1 (BL1), assuming no hazardous vectors or high-risk modifications are involved. Implement standard recombinant DNA laboratory practices including designated work areas, proper waste disposal protocols, and regular decontamination of surfaces. For animal studies, containment levels should be determined based on the specific experimental design - standard transgenic rodents expressing gorilla CHRM3 typically require Animal Biosafety Level 1 (ABSL-1) facilities, while experiments involving viral vectors may require ABSL-2. Develop comprehensive standard operating procedures (SOPs) addressing potential exposure risks, particularly if using viral expression systems. For larger animal models, additional considerations apply as described in Appendix Q of the NIH Guidelines, including appropriate housing, inventory tracking, and carcass disposal protocols . All personnel should receive specific training on both general biosafety practices and particular precautions for the experimental system utilized. The institutional Biosafety Committee should review and approve all protocols before work begins, with regular reassessment as methodologies evolve.

What documentation and approvals are required for breeding transgenic animals expressing gorilla CHRM3?

Breeding transgenic animals expressing gorilla CHRM3 requires comprehensive documentation and specific regulatory approvals. First, all breeding protocols must receive prior approval from the Institutional Biosafety Committee (IBC), with detailed documentation of parental lines, breeding strategies, and expected genetic outcomes. Certain breeding scenarios may be exempt under Appendix C-VIII of the NIH Guidelines, specifically breeding of two different transgenic rodent lines or breeding transgenic with non-transgenic rodents if: (1) both parental rodents can be housed under BL1 containment; (2) neither parental transgenic rodent contains more than half the genome of an exogenous eukaryotic virus from a single family or has a transgene under a gammaretroviral LTR; and (3) the resulting transgenic rodent will not contain more than half an exogenous viral genome from a single family . For non-exempt breeding, detailed animal tracking systems must be implemented, including permanent identification of animals, comprehensive breeding records, and documentation of experimental use and disposal. For large animal models expressing gorilla CHRM3, additional requirements apply as specified in Appendix Q of the NIH Guidelines, including inventory controls and specific disposal procedures to prevent food chain entry . All protocols must also receive approval from the Institutional Animal Care and Use Committee (IACUC), addressing welfare considerations beyond biosafety aspects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.