Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NDUFA11; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11; Complex I-B14.7; CI-B14.7; NADH-ubiquinone oxidoreductase subunit B14.7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-141
Protein Length
Full Length of Mature Protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTF TAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIA ASLVKMGQLEGWEVFAKPKV
Uniprot No.

Target Background

Function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone likely serving as the immediate electron acceptor.

Database Links
Protein Families
Complex I NDUFA11 subunit family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein; Matrix side.

Q&A

What is the function of NDUFA11 in mitochondrial respiration?

NDUFA11 is a supernumerary membrane subunit of Complex I (NADH:ubiquinone oxidoreductase) in the mitochondrial electron transport chain. It plays a critical role in the assembly and stability of the respirasome, which is essential for efficient electron transfer and oxidative phosphorylation. Research has demonstrated that NDUFA11 is integral to the structural integrity of Complex I and its association with other respiratory complexes to form supercomplexes .

Methodologically, the function of NDUFA11 has been investigated using gene silencing approaches (siRNA knockdown) in cell culture models, which have shown that decreased NDUFA11 expression leads to disruption of the respirasome and reduced activity of Complexes I, III, and IV . This highlights its importance not only for Complex I stability but also for the coordinated function of the entire respiratory chain.

How is NDUFA11 structurally integrated into Complex I?

NDUFA11 is positioned within the membrane arm of Complex I, serving as an intrinsic component that facilitates the assembly and stability of the complex. Structural studies using cryo-electron microscopy and biochemical analyses indicate that NDUFA11 interacts with other subunits to maintain the architectural integrity of Complex I .

To investigate this structural integration, researchers typically employ blue native polyacrylamide gel electrophoresis (BN-PAGE) combined with in-gel activity assays to visualize intact complexes and subcomplexes . Additionally, co-immunoprecipitation and crosslinking experiments can reveal direct protein-protein interactions. These methodological approaches have demonstrated that NDUFA11 depletion leads to the accumulation of subcomplexes with molecular masses of approximately 550 and 815 kDa, indicating incomplete assembly of Complex I .

What are the optimal methods for silencing NDUFA11 expression in cellular models?

For effective silencing of NDUFA11 expression, RNA interference (RNAi) using small interfering RNAs (siRNAs) has proven successful. Research protocols typically employ at least two distinct siRNA sequences targeting different regions of the NDUFA11 mRNA to confirm specificity of the observed effects . The optimal transfection conditions depend on the cell type being studied.

A methodological workflow for NDUFA11 silencing includes:

  • Design and validation of siRNA sequences targeting conserved regions of NDUFA11

  • Optimization of transfection conditions (reagent concentration, cell density, incubation time)

  • Confirmation of knockdown efficiency via Western blot analysis (33-38% reduction has been reported as sufficient to observe phenotypic effects)

  • Assessment of cell viability (significant decreases of 41-47% have been observed following NDUFA11 knockdown)

  • Evaluation of mitochondrial function through respiration assays, ATP measurements, and ROS detection

The timing of analyses is critical, as prolonged NDUFA11 deficiency may lead to compensatory mechanisms or cell death, potentially confounding experimental results.

How can researchers effectively measure the impact of NDUFA11 depletion on mitochondrial function?

A comprehensive assessment of mitochondrial function following NDUFA11 depletion requires multiple complementary approaches:

  • Respiratory complex activity assays: Spectrophotometric measurements of NADH oxidation (Complex I), succinate oxidation (Complex II), and cytochrome c reduction/oxidation (Complexes III and IV)

  • ATP synthesis measurements: Luminescence-based assays have demonstrated approximately 48% reduction in ATP levels following NDUFA11 knockdown

  • Mitochondrial membrane potential (ΔΨm) assessment: Using fluorescent dyes such as TMRM or JC-1, with research showing 14-47% reduction in ΔΨm following NDUFA11 silencing

  • ROS production measurement: MitoSOX fluorescence has revealed 30-62% increases in mitochondrial ROS production in NDUFA11-depleted cells

  • Respiratory supercomplexes analysis: BN-PAGE followed by immunoblotting or in-gel activity assays to visualize changes in supercomplex formation, with studies showing 13-30% decrease in respirasome levels after NDUFA11 knockdown

Each of these measurements provides complementary information about the functional consequences of NDUFA11 deficiency, allowing researchers to build a comprehensive understanding of its role in mitochondrial physiology.

How does NDUFA11 contribute to respirasome assembly and stability?

NDUFA11 plays a critical role in respirasome assembly and stability through several mechanisms:

  • Structural support: NDUFA11 provides structural integrity to Complex I, particularly within its membrane domain, which is essential for the proper assembly of the respirasome

  • Inter-complex interactions: Evidence suggests that NDUFA11 may facilitate interactions between Complex I and other respiratory complexes (III and IV) within the respirasome

  • Assembly pathway regulation: NDUFA11 appears to function as an intrinsic assembly factor, with its depletion leading to accumulation of specific assembly intermediates (550 and 815 kDa subcomplexes)

Experimentally, researchers have established these functions through comparative analysis of respirasome levels and stability in control versus NDUFA11-depleted cells. BN-PAGE techniques have shown that silencing NDUFA11 expression results in a 13-30% decrease in respirasome levels, while having no effect on individual Complex II stability . This selective impact on the respirasome but not on all respiratory complexes highlights the specific role of NDUFA11 in supercomplex formation and maintenance.

What is the relationship between NDUFA11 and known Complex I assembly factors?

NDUFA11 has a complex relationship with established Complex I assembly factors. When NDUFA11 expression is suppressed, several known assembly factors associate with the resulting subcomplexes:

  • NDUFAF1-4: These assembly factors become associated with NDUFA11-deficient subcomplexes, suggesting they may attempt to compensate for or remedy the assembly defect

  • ACAD9, ECSIT, FOXRED1, and TMEM126B: These factors also accumulate with Complex I subcomplexes in NDUFA11-deficient cells

  • C3orf1: This protein was identified as potentially important for Complex I assembly through its association with NDUFA11-deficient subcomplexes

The methodological approach to establish these relationships involved SILAC (Stable Isotope Labeling by Amino acids in Cell culture) combined with mass spectrometry to quantify differences in protein levels and associations between control and NDUFA11-suppressed cells . This revealed that while NDUFA11 depletion did not significantly change the expression levels of assembly factors, it altered their association with Complex I subcomplexes, suggesting a role for NDUFA11 in normal assembly factor dynamics.

How does NDUFA11 depletion affect development and physiology in model organisms?

Studies in Caenorhabditis elegans have provided valuable insights into the developmental consequences of NDUFA11 deficiency:

  • Complete knockout phenotype: C. elegans with homozygous deletion of the NDUFA11 homolog (nduf-11) exhibit developmental arrest at the second larval (L2) stage, indicating that NDUFA11 is essential for normal development

  • Partial depletion effects: RNAi-mediated reduction of NDUFA11 allows development to adulthood but results in:

    • Smaller and thinner adult animals

    • Reduced reproductive capacity

    • Altered mitochondrial morphology with aberrant cristae and widened cristae junctions

These findings demonstrate that even partial NDUFA11 deficiency can have significant physiological consequences. The methodological approach of comparing complete knockout versus partial knockdown has proven valuable for understanding the dose-dependent effects of NDUFA11 on development and physiology.

What metabolic adaptations occur in response to NDUFA11 deficiency?

NDUFA11 deficiency triggers significant metabolic rewiring to compensate for impaired Complex I function:

  • Enhanced Complex II activity: Cells compensate for reduced NADH dehydrogenase activity by upregulating Complex II function, although this may increase harmful ROS production

  • TCA cycle remodeling: Quantitative proteomics analysis reveals a shift from the traditional TCA cycle toward the glyoxylate cycle

  • Upregulation of fatty acid catabolism: Increased expression of enzymes involved in fatty acid oxidation, including acyl-CoA synthetase (ACS-2 in C. elegans)

  • Amino acid metabolism changes: Enhanced amino acid breakdown and propanoyl-CoA pathway activity to replenish TCA/glyoxylate cycle intermediates

  • Altered glycolysis-gluconeogenesis balance: Upregulation of both glycolytic and gluconeogenic enzymes, potentially creating metabolic futile cycles

These adaptations demonstrate the complex cellular response to mitochondrial dysfunction caused by NDUFA11 deficiency. Methodologically, researchers use quantitative mass spectrometry comparing proteomes of control and NDUFA11-depleted samples to identify these adaptive changes, with studies showing that less than 10% of the detected proteome (of approximately 6440 proteins) is significantly altered, indicating a specific rather than general response .

How do mutations in NDUFA11 contribute to mitochondrial disease pathogenesis?

While the search results don't specifically address NDUFA11 mutations in human disease, the experimental evidence from model systems provides insight into potential disease mechanisms:

  • Energy deficiency: NDUFA11 depletion reduces ATP production by approximately 48%, which could significantly impact energy-demanding tissues like muscle and neurons

  • Oxidative stress: Increased mitochondrial ROS production (30-62% higher) following NDUFA11 knockdown may contribute to cellular damage and dysfunction

  • Membrane potential disruption: Reduced ΔΨm (14-47% lower) could affect mitochondrial protein import, calcium handling, and organelle dynamics

  • Developmental consequences: The developmental arrest observed in C. elegans suggests that NDUFA11 deficiency during critical developmental periods could have severe consequences

Research approaches to investigate NDUFA11-related disease mechanisms should include:

  • Patient-derived cell models

  • Genetic rescue experiments

  • Tissue-specific conditional knockout models

  • Metabolic flux analysis to quantify pathway adaptations

  • Therapeutic interventions targeting downstream effects (e.g., antioxidants for ROS, metabolic substrates for energy deficiency)

What are the experimental challenges in distinguishing direct versus indirect effects of NDUFA11 deficiency?

Researchers face several methodological challenges when studying NDUFA11:

  • Temporal considerations: Acute versus chronic NDUFA11 deficiency may trigger different compensatory mechanisms, necessitating time-course studies

  • Tissue specificity: Different cell types show varied responses to NDUFA11 depletion, as evidenced by the downregulation of germline-specific isoforms SDHA-2 and ASB-1 in C. elegans studies

  • Separating assembly versus functional roles: Determining whether phenotypes result from structural defects in Complex I/supercomplexes or from direct functional roles of NDUFA11 requires careful experimental design

  • Distinguishing primary from secondary effects: Changes in metabolism, ROS production, and membrane potential may represent either direct consequences of NDUFA11 deficiency or adaptive responses

To address these challenges, researchers should consider:

  • Employing inducible knockdown/knockout systems to control the timing of NDUFA11 depletion

  • Using tissue-specific promoters to target NDUFA11 deficiency to relevant cell types

  • Performing rescue experiments with wildtype and mutant NDUFA11 to identify critical functional domains

  • Conducting parallel experiments with inhibitors of Complex I enzymatic activity to distinguish assembly from functional defects

What cryo-electron microscopy techniques are most effective for studying NDUFA11's role in Complex I structure?

Advanced cryo-electron microscopy (cryo-EM) approaches have revolutionized our understanding of respiratory complex structures. For NDUFA11 research:

  • Single-particle cryo-EM: This approach has been used to determine structures of Complex I assembly intermediates, including those associated with assembly factors like NDUFAF1

  • Cryo-electron tomography: This technique has revealed aberrant cristae morphology and widening of cristae junctions following NDUFA11 depletion in C. elegans, connecting structural changes at the protein complex level to organelle morphology

The methodological workflow for cryo-EM studies of NDUFA11 typically includes:

  • Isolation of mitochondria from control and NDUFA11-depleted cells

  • Solubilization of membrane complexes using mild detergents

  • Purification of complexes using affinity tags

  • Cryo-EM data collection and image processing

  • 3D reconstruction and modeling, often using AlphaFold predictions as templates for building structural models

Structures determined using these approaches have achieved resolutions of 2.9-3.2 Å, allowing detailed analysis of protein-protein interactions within the complex .

How can proteomics approaches be optimized to study NDUFA11-dependent protein interactions?

Proteomics methodologies provide powerful tools for understanding NDUFA11's interactions and functions:

For optimal results, researchers should consider:

  • Using multiple complementary proteomics approaches

  • Implementing appropriate controls, including multiple siRNA sequences or gene deletion strategies

  • Analyzing both soluble and membrane fractions separately

  • Employing data analysis pipelines that can detect both direct binding partners and proteins affected by secondary processes

By combining these proteomics approaches with functional assays, researchers can develop a comprehensive understanding of how NDUFA11 contributes to Complex I assembly, stability, and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.