Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (NDUFB6)

Shipped with Ice Packs
In Stock

Description

Introduction

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, also known as complex I-B17, is a protein that in humans is encoded by the NDUFB6 gene . It is an accessory subunit of the NADH dehydrogenase (ubiquinone) complex, located in the mitochondrial inner membrane . Complex I is the largest of the five complexes of the electron transport chain . NDUFB6 is believed to not be directly involved in catalysis .

Gene Information

The NDUFB6 gene is located on the p arm of chromosome 9 in position 21.1 and is 19,659 base pairs long .

Protein Structure

The NDUFB6 protein has a molecular weight of 15.5 kDa and consists of 128 amino acids . The structure is L-shaped, featuring a long, hydrophobic transmembrane domain and a hydrophilic domain for the peripheral arm, which includes all known redox centers and the NADH binding site . The N-terminal hydrophobic domain can potentially fold into an alpha helix spanning the inner mitochondrial membrane, while the C-terminal hydrophilic domain interacts with globular subunits of Complex I . The conserved two-domain structure suggests that the hydrophobic domain acts as an anchor for the NADH dehydrogenase (ubiquinone) complex at the inner mitochondrial membrane, which is critical for the protein's function .

Function

Initially, NADH binds to Complex I and transfers two electrons to the isoalloxazine ring of the flavin mononucleotide (FMN) prosthetic arm to form FMNH$$_2$$ . The electrons are then transferred through a series of iron-sulfur (Fe-S) clusters in the prosthetic arm and finally to coenzyme Q10 (CoQ), which is reduced to ubiquinol (CoQH$$_2$$) . The flow of electrons changes the redox state of the protein, resulting in a conformational change and pK shift of the ionizable side chain, which pumps four hydrogen ions out of the mitochondrial matrix .

Clinical Significance

Decreased expression of genes involved in oxidative phosphorylation, including NDUFB6, is associated with insulin resistance and type 2 diabetes . A polymorphism in the promoter region of the NDUFB6 gene resulting in an adenine to guanine shift at rs629566 was shown to create a DNA methylation site that is associated with a decline in NDUFB6 expression in muscle of aging patients .

A study found that the NDUFB6 rs540467 SNP modifies physical activity-mediated changes in insulin sensitivity, body composition, and liver fat estimates in type 2 diabetes .

Individuals with type 2 diabetes carrying the G/G genotype of the NDUFB6 SNP rs540467 exhibited a positive correlation between changes in M-value and physical activity levels compared to carriers of the A-allele showing no such association of these variables .

In vitro inhibition of NDUFB6 leads to reduced mitochondrial respiration . After palmitate-induced insulin resistance, contractions were not able to protect against palmitate-induced insulin resistance after NDUFB6 silencing .

Young twins with the rs629566 G/G genotype had greater relative NDUFB6 mRNA expression in muscle compared with young twins carrying the A/G or * A/A* genotypes . In contrast, elderly twins carrying the rs629566 G/G genotype had lower relative muscle NDUFB6 mRNA levels than did carriers of the A/G or A/A .

Relevant Tables

Table 1: NDUFB6 Identifiers

CategoryDetails
AliasesNDUFB6, B17, CI, NADH:ubiquinone oxidoreductase subunit B6
External IDsOMIM: 603322; MGI: 2684983; HomoloGene: 1864; GeneCards: NDUFB6; OMA:NDUFB6 - orthologs
Wikidata

Table 2: Subgroup analysis of changes (Δ) of anthropometric, performance and metabolic parameters based on response to changes in whole-body insulin sensitivity and PA participation over 5 years for patients with type 2 diabetes, divided into responders (n=17), Q2 (n=5), Q3 (n=23) and non-responders (n=30) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
NDUFB6; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; Complex I-B17; CI-B17; NADH-ubiquinone oxidoreductase B17 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-128
Protein Length
Full Length of Mature Protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMV HGVYQKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMK EFPDQHH
Uniprot No.

Target Background

Function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.

Database Links
Protein Families
Complex I NDUFB6 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is NDUFB6 and what is its role in cellular metabolism?

NDUFB6 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6) is an accessory subunit of the multisubunit NADH:ubiquinone oxidoreductase (Complex I) located in the mitochondrial inner membrane. This complex is the largest of the five complexes in the electron transport chain. While NDUFB6 is not directly involved in catalysis, it is required for electron transfer activity in the respiratory chain. The protein plays a crucial role in mitochondrial oxidative phosphorylation, which is essential for cellular energy production .

The structural characteristics of NDUFB6 include an L-shaped configuration with a long, hydrophobic transmembrane domain and a hydrophilic domain for the peripheral arm that includes redox centers and the NADH binding site. The N-terminal hydrophobic domain can fold into an alpha helix that spans the inner mitochondrial membrane, while the C-terminal hydrophilic domain interacts with globular subunits of Complex I .

What are the structural characteristics of gorilla NDUFB6 compared to human NDUFB6?

Gorilla gorilla gorilla NDUFB6 shares significant structural homology with human NDUFB6, reflecting their close evolutionary relationship. Both proteins function as accessory subunits in Complex I of the respiratory chain and possess the characteristic two-domain structure: a hydrophobic transmembrane domain that anchors the protein to the inner mitochondrial membrane and a hydrophilic domain that interacts with other Complex I subunits .

The highly conserved two-domain structure across species suggests that this feature is critical for the protein's function, particularly in anchoring the NADH dehydrogenase complex at the inner mitochondrial membrane. This conservation indicates evolutionary pressure to maintain the functional integrity of the electron transport chain across primate species .

What are the optimal conditions for reconstitution and storage of recombinant gorilla NDUFB6?

For optimal reconstitution of lyophilized recombinant Gorilla gorilla gorilla NDUFB6, the protein should be briefly centrifuged prior to opening to ensure contents are at the bottom of the vial. Reconstitution should be performed in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and aliquot the solution for storage at -20°C/-80°C .

Repeated freezing and thawing cycles significantly reduce protein stability and activity, so working aliquots should be stored at 4°C for up to one week. The shelf life of the liquid form is typically 6 months when stored at -20°C/-80°C, while the lyophilized form maintains stability for approximately 12 months at the same storage temperatures .

How can researchers validate the purity and activity of recombinant gorilla NDUFB6?

Researchers can validate the purity of recombinant gorilla NDUFB6 using SDS-PAGE, with commercial preparations typically showing >85% purity . For activity assessment, researchers should measure the protein's ability to facilitate electron transfer within Complex I. This can be done using enzymatic assays that monitor NADH oxidation or ubiquinone reduction rates.

When validating recombinant NDUFB6 for experimental use, it's essential to confirm both structural integrity and functional activity. Since NDUFB6 is an accessory subunit required for electron transfer in Complex I, reconstitution experiments with isolated Complex I lacking NDUFB6 can demonstrate the protein's functionality by restoring electron transfer activity.

How is NDUFB6 expression regulated by genetic and epigenetic factors?

NDUFB6 expression is regulated by both genetic polymorphisms and epigenetic modifications. A key polymorphism, rs629566 (A/G), located at position -544 in the NDUFB6 promoter region, introduces a potential DNA methylation site by changing the sequence CA to CG. This polymorphism also resides in a putative transcription factor-binding site .

What is the role of NDUFB6 in cancer biology, particularly in relation to radioresistance?

Recent studies have implicated mitochondrial dysfunction, particularly defects in Complex I components including NDUFB6, in the development of radioresistance in colorectal cancer (CRC). Degradation of Complex I components (NDUFB5, NDUFB6) has been shown to participate in glycolytic reprogramming and promote CRC development .

Complex I acts as the rate-limiting step in electron transfer and plays a central role in mitochondrial oxidative respiration. Research has demonstrated that NDUFS1 (another component of Complex I) overexpression can enhance mitochondrial metabolism and increase radiosensitivity. This suggests that modulation of Complex I function, potentially including NDUFB6, could be a therapeutic approach to improve the efficacy of radiotherapy in colorectal cancer .

The mechanism involves a [Ca2+]m-PDP1-PDH-histone acetylation retrograde signaling pathway activated by mitochondrial Complex I defects that contributes to cancer cell radioresistance. This finding provides new insights into mitochondrial retrograde signaling and suggests that modification of Complex I function may improve clinical benefits of radiotherapy in CRC .

How does gorilla NDUFB6 compare to other primate NDUFB6 proteins in terms of sequence conservation and functional differences?

The high degree of sequence conservation of NDUFB6 across primate species reflects the critical importance of this protein in mitochondrial function. Comparative genomic analyses indicate that the two-domain structure is particularly well-preserved, suggesting evolutionary constraints on structural modifications that might compromise electron transport chain efficiency .

Functional studies comparing gorilla NDUFB6 with its orthologs in other primates can provide insights into the evolution of mitochondrial energy metabolism in these species. While the core function remains conserved, subtle variations in amino acid sequences may influence protein-protein interactions within Complex I, potentially reflecting adaptations to different metabolic demands across primate species.

Could gorilla NDUFB6 be used as a model for studying human mitochondrial diseases related to Complex I deficiency?

Given the structural similarities between gorilla and human NDUFB6, recombinant gorilla NDUFB6 could serve as a valuable model for investigating human mitochondrial diseases associated with Complex I deficiency. The use of non-human primate proteins offers advantages in terms of evolutionary proximity while avoiding ethical constraints associated with human samples .

Comparative studies using gorilla NDUFB6 could help elucidate the pathophysiological mechanisms underlying human mitochondrial disorders, particularly those involving Complex I dysfunction. By creating in vitro models incorporating recombinant gorilla NDUFB6, researchers can investigate how specific mutations affect protein stability, Complex I assembly, and electron transfer function, potentially leading to novel therapeutic approaches for mitochondrial diseases.

What are the key considerations when designing experiments to study NDUFB6 function in mitochondrial metabolism?

When designing experiments to study NDUFB6 function in mitochondrial metabolism, researchers should consider several factors:

  • Isolation protocols: Proper isolation of mitochondria while preserving Complex I integrity is crucial. This typically involves gentle homogenization techniques and differential centrifugation.

  • Functional assays: Experiments should include measurements of:

    • Complex I activity (NADH:ubiquinone oxidoreductase activity)

    • Oxygen consumption rates

    • Membrane potential measurements

    • ATP production

  • Protein interaction studies: Co-immunoprecipitation or proximity labeling approaches can identify NDUFB6 interaction partners within Complex I and potentially other mitochondrial proteins.

  • Control conditions: Include appropriate controls for protein expression, localization, and functional studies, including comparison with other species' NDUFB6 proteins when relevant.

How can researchers effectively use recombinant gorilla NDUFB6 in studies of mitochondrial Complex I assembly and function?

Recombinant gorilla NDUFB6 can be effectively used in reconstitution experiments to study Complex I assembly and function. One approach is to use NDUFB6-depleted mitochondrial preparations to which the recombinant protein is added back. Researchers should consider the following methodological aspects:

  • Reconstitution conditions: Optimizing buffer composition, pH, and ionic strength is critical for successful incorporation of recombinant NDUFB6 into Complex I.

  • Functional rescue experiments: Measure the restoration of Complex I activity following NDUFB6 reconstitution to assess the protein's functional contribution.

  • Structural studies: Use techniques such as cryo-electron microscopy to visualize the integration of recombinant NDUFB6 into the Complex I structure.

  • Interaction mapping: Employ chemical crosslinking and mass spectrometry to identify the precise interactions between NDUFB6 and other Complex I subunits.

How might research on gorilla NDUFB6 contribute to understanding human metabolic disorders?

Research on gorilla NDUFB6 can provide valuable insights into human metabolic disorders, particularly those involving mitochondrial dysfunction. The conservation of NDUFB6 structure and function across primates suggests that findings from gorilla NDUFB6 studies may be applicable to human disease mechanisms .

Complex I deficiencies are involved in various human disorders, including neurodegenerative diseases and metabolic syndromes. By studying the molecular details of gorilla NDUFB6 function and comparing them with human NDUFB6, researchers can identify critical regions and interactions that, when disrupted, may contribute to disease pathogenesis. This comparative approach may reveal evolutionary adaptations that influence susceptibility to specific metabolic disorders.

What is the potential role of NDUFB6 in cancer metabolism and therapy resistance?

NDUFB6 and other Complex I components play significant roles in cancer metabolism and therapy resistance. Degradation of Complex I components including NDUFB6 has been linked to glycolytic reprogramming in colorectal cancer, supporting tumor development .

Mitochondrial dysfunction, specifically Complex I defects, has been shown to contribute to radioresistance in colorectal cancer through a [Ca2+]m-PDP1-PDH-histone acetylation retrograde signaling pathway. This mechanism affects DNA damage repair responses by reducing histone acetylation. Interestingly, restoring Complex I function by overexpressing NDUFS1 (another Complex I component) has been shown to reverse glycolysis and resensitize cancer cells to radiation both in vitro and in vivo .

These findings suggest that therapeutic approaches targeting Complex I components, potentially including NDUFB6, could overcome therapy resistance in certain cancers. Low expression of Complex I components has been correlated with poor tumor regression grading in colorectal cancer patients undergoing neoadjuvant radiotherapy, highlighting their potential as predictive biomarkers .

What novel approaches can be used to study the role of NDUFB6 in mitochondrial retrograde signaling?

Innovative approaches to study NDUFB6's role in mitochondrial retrograde signaling include:

  • Proximity labeling techniques: Methods such as BioID or APEX2 can identify proteins that interact with NDUFB6 in living cells, helping to map signaling networks.

  • Live-cell imaging with fluorescent sensors: Using genetically encoded sensors for calcium, redox status, or metabolites in combination with NDUFB6 manipulation can reveal real-time changes in retrograde signaling.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from models with altered NDUFB6 expression can provide a comprehensive view of retrograde signaling pathways.

  • CRISPR-based screening: Genome-wide or targeted CRISPR screens in the context of NDUFB6 modulation can identify critical components of retrograde signaling networks.

Research has shown that Complex I defects, including those involving NDUFB6, can trigger retrograde signaling pathways that affect nuclear gene expression and cellular functions, including DNA damage repair responses critical for radiation sensitivity in cancer cells .

How can epigenetic regulation of NDUFB6 be effectively studied in different tissue contexts?

To effectively study epigenetic regulation of NDUFB6 in different tissue contexts, researchers can employ several methodological approaches:

  • Tissue-specific methylation analysis: Bisulfite sequencing of the NDUFB6 promoter region across different tissues can reveal tissue-specific methylation patterns, particularly at the rs629566 polymorphism site which has been shown to introduce a methylation site when the G allele is present .

  • ChIP-seq for histone modifications: Chromatin immunoprecipitation followed by sequencing can identify tissue-specific histone modification patterns at the NDUFB6 locus.

  • Single-cell approaches: Single-cell DNA methylation and RNA-seq analyses can reveal cell-type specific epigenetic regulation of NDUFB6 within heterogeneous tissues.

  • Genomic editing of regulatory elements: CRISPR-based editing of specific regulatory elements, such as the rs629566 polymorphism site, can help determine their functional significance in different tissue contexts.

Research has demonstrated age-associated methylation of the NDUFB6 promoter in carriers of specific genotypes, which correlates with reduced gene expression. This suggests that epigenetic regulation of NDUFB6 may contribute to age-related metabolic changes in specific tissues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.