Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
NDUFB8; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial; Complex I-ASHI; CI-ASHI; NADH-ubiquinone oxidoreductase ASHI subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-186
Protein Length
Full Length of Mature Protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDP WYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPISWHVMCMQLFGFLAFMIFMCWVGD VYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
Uniprot No.

Target Background

Function

NDUFB8 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the primary electron acceptor.

Database Links
Protein Families
Complex I NDUFB8 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is NDUFB8 and what is its role in mitochondrial function?

NDUFB8 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8) is a nuclear-encoded accessory subunit that is essential for the stability and activity of mitochondrial complex I. Located at chromosome 10q24.31 in humans, this protein is integral to the proper functioning of the electron transport chain in mitochondria . As part of complex I (also known as NADH:ubiquinone oxidoreductase), NDUFB8 contributes to the transfer of electrons from NADH to ubiquinone, which is the first step in the respiratory chain that ultimately leads to ATP synthesis. The protein is also referred to as "Complex I-ASHI" or "CI-ASHI" in some literature .

How does the structure of gorilla NDUFB8 compare to human NDUFB8?

The recombinant Gorilla gorilla gorilla NDUFB8 shares significant sequence homology with human NDUFB8, reflecting the evolutionary conservation of this critical mitochondrial protein. Sequence alignment analyses reveal high conservation across primates, which suggests functional importance of specific domains . While the core catalytic functions are preserved, subtle amino acid differences may affect protein-protein interactions within the respiratory complex. Researchers should note that when using gorilla NDUFB8 as a model system, these minor differences might influence experimental outcomes when extrapolating to human mitochondrial function.

What post-translational modifications affect NDUFB8 function?

Tyrosine nitration is a critical post-translational modification that affects NDUFB8 function. Research indicates that reactive nitrogen species (RNS) can induce nitration of NDUFB8 in endothelial cells, which coincides with disruptions in mitochondrial membrane potential and inhibition of mitochondrial bioenergetics . This modification leads to reduced complex I activity, decreased mitochondrial oxygen consumption, and altered ADP/ATP ratio, ultimately resulting in necrotic cell death. The nitration process is dependent on mitochondrial superoxide generation and can be reversed by overexpression of manganese superoxide dismutase (MnSOD), highlighting the importance of understanding redox balance in NDUFB8 research .

What are the optimal conditions for reconstitution and storage of recombinant NDUFB8?

Recombinant NDUFB8 protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being standard) and aliquot for storage at -20°C/-80°C to prevent repeated freeze-thaw cycles . Prior to opening, the vial should be briefly centrifuged to bring contents to the bottom. Working aliquots can be stored at 4°C for up to one week. The shelf life is approximately 6 months for liquid form at -20°C/-80°C and 12 months for lyophilized form at the same temperatures, though this can vary based on buffer ingredients and the stability of the protein itself .

How can researchers effectively perform complementation studies with NDUFB8?

Complementation studies with NDUFB8 require the following methodological approach:

  • Amplify wild-type NDUFB8 sequence from control cDNA

  • Clone the sequence into an appropriate expression vector (e.g., pLenti6.3/V5-TOPO TA Cloning Kit)

  • Transduce patient-derived fibroblasts with the expression construct

  • Perform functional assessments through multiple assays:

    • Enzymatic activity measurements of isolated mitochondria

    • Microscale respirometry

    • Western blotting for protein expression analysis

    • Flow cytometry analysis

    • Immunohistochemical staining

This approach has successfully demonstrated restoration of mitochondrial function in complex I-deficient cells, confirming the causal role of NDUFB8 mutations in complex I deficiency . Researchers should monitor cell growth carefully post-transduction, as some patient cell lines may not grow sufficiently well for all analytical methods.

What techniques are most effective for detecting NDUFB8 nitration and its effects?

To effectively detect and analyze NDUFB8 nitration, researchers can employ a multi-method approach:

  • Protein Immunoprecipitation: Using anti-nitrotyrosine antibodies followed by Western blotting with NDUFB8-specific antibodies to identify nitrated NDUFB8.

  • Mass Spectrometry: For precise identification of nitrated tyrosine residues and quantification of nitration levels.

  • Functional Assays: Measuring complex I activity through spectrophotometric assays that track NADH oxidation or ubiquinone reduction.

  • Mitochondrial Membrane Potential Assessment: Using fluorescent probes (e.g., JC-1 or TMRM) to evaluate the impact of nitration on membrane potential.

  • Oxygen Consumption Measurements: Employing high-resolution respirometry to assess the functional consequences of NDUFB8 nitration on mitochondrial respiration .

Additionally, researchers can use RNA interference with specific siRNAs (e.g., 5′-GAGAGAGAUCCAUGGUAUAtt-3′ and 5′-GACCAAAGCAGUAUCCUUAtt-3′) to modulate NDUFB8 expression levels and study the correlation between protein levels and nitration effects .

How do NDUFB8 mutations contribute to mitochondrial diseases?

NDUFB8 mutations have been established as causative factors in mitochondrial complex I deficiency, which manifests as severe childhood-onset mitochondrial disease with encephalo(cardio)myopathic features. Clinical manifestations include:

  • Muscular hypotonia

  • Cardiac hypertrophy

  • Respiratory failure

  • Failure to thrive

  • Developmental delay

  • Elevated blood lactate levels

  • Progressive changes in basal ganglia, brain stem, or internal capsule visible on neuroimaging

The biochemical hallmark is an isolated decrease in complex I enzymatic activity in muscle and fibroblasts. Complementation studies have conclusively demonstrated that restoration of wild-type NDUFB8 expression can rescue mitochondrial function, confirming that NDUFB8 variants are directly responsible for the observed complex I deficiency .

What is the relationship between NDUFB8, Leigh's disease, and lactic acidosis?

Homozygous mutations in the NDUFB8 gene have been associated with Leigh's disease (subacute necrotizing encephalomyelopathy) in neonates. A case study described a term neonate born to consanguineous parents who developed seizures, depressed sensorium, and failure to gain weight at 3 weeks of age . The clinical presentation included:

  • Ventilator dependence

  • Progressive encephalopathy

  • Elevated blood and cerebrospinal fluid lactate levels

  • Diffusion restriction in the medulla, basal ganglia, and pericentral cortex on MRI

  • Development of cerebral edema and irreversible brain injury despite medical treatment for congenital lactic acidosis

This clinical presentation is consistent with mitochondrial complex I deficiency caused by the NDUFB8 mutation, which disrupts oxidative phosphorylation and energy metabolism, leading to lactic acid accumulation and the neurological manifestations characteristic of Leigh's disease.

How can NDUFB8 dysfunction be classified in clinical samples?

Classification of NDUFB8 dysfunction in clinical samples, particularly in skeletal myofibers, has been challenging. Traditional frequentist linear model approaches have shown limitations in accurately classifying NDUFB8 status. A comparison of classification methods for OXPHOS (Oxidative Phosphorylation) deficient skeletal myofibers revealed:

Classification MethodAccuracy with NDUFB8Limitations
Frequentist Linear ModelPoor (79% misclassification rate)Does not allow for single-myofibre deviation from control subjects
Bayesian ClassificationHigh (only 2% misclassification)More accurately matches manual classification
Manual Expert ClassificationReference standardTime-consuming and subjective

The Bayesian approach has demonstrated superior performance because it accommodates natural genetic and environmental variability between human subjects. This is particularly important given the ethical and financial constraints that typically limit the number of healthy control biopsies available for comparison .

How can researchers distinguish between direct and indirect effects of NDUFB8 manipulation in complex I function studies?

Distinguishing between direct and indirect effects of NDUFB8 manipulation requires a multi-faceted experimental approach:

  • Temporal Analysis: Monitor changes in mitochondrial function at multiple time points post-NDUFB8 manipulation to identify primary (early) versus secondary (late) effects.

  • Dose-Dependency Studies: Establish a correlation between the degree of NDUFB8 modification and functional outcomes to identify direct relationships.

  • Structural Analysis: Employ cryo-EM or similar techniques to visualize structural changes in complex I following NDUFB8 manipulation.

  • Parallel Pathway Assessment: Simultaneously measure multiple mitochondrial parameters (membrane potential, ROS production, ATP synthesis) to identify which changes occur concurrently with NDUFB8 manipulation.

  • Rescue Experiments: Use targeted approaches to correct specific downstream effects while maintaining NDUFB8 manipulation to determine causal relationships .

Additionally, researchers should consider employing NDUFB8 variants with specific mutations that affect particular functions but not others to delineate the protein's multiple roles in complex I assembly and activity.

What statistical approaches are most appropriate for analyzing NDUFB8 expression and function data?

When analyzing NDUFB8 expression and function data, Bayesian statistical approaches have demonstrated superior performance compared to traditional frequentist methods. The limitations of frequentist linear models are particularly evident when classifying OXPHOS protein abundance in patient samples, where misclassification rates can reach up to 79% for NDUFB8 .

A Bayesian hierarchical model offers several advantages:

  • It accommodates natural variability between human subjects

  • It does not require the strong assumption that patient myofibre OXPHOS protein abundance cannot deviate from control subjects

  • It better handles the typically small sample sizes of healthy control biopsies

  • It provides more informative posterior distributions for parameters like slope and intercept

The Bayesian approach encodes updated parameter beliefs through joint posterior distributions over all levels of hierarchy. As shown in comparative analyses, this method consistently achieves classification accuracy that closely matches expert manual classification, with misclassification rates as low as 2% for NDUFB8 compared to 79% for frequentist methods .

How do experimental conditions affect the stability and activity of recombinant NDUFB8?

Recombinant NDUFB8 stability and activity are influenced by multiple experimental factors:

  • Temperature: Storage at -20°C/-80°C is optimal for long-term preservation, with shelf life approximately 6 months for liquid form and 12 months for lyophilized form .

  • Buffer Composition: Buffer ingredients significantly impact stability, with glycerol addition (typically 50%) recommended for long-term storage .

  • Freeze-Thaw Cycles: Repeated freezing and thawing substantially reduce protein activity and should be avoided; working aliquots should be stored at 4°C for no more than one week .

  • Protein Concentration: Reconstitution to 0.1-1.0 mg/mL provides optimal stability; concentrations outside this range may accelerate degradation or aggregation .

  • Oxidative Environment: As a mitochondrial protein, NDUFB8 is sensitive to oxidation, which can alter its functional properties and stability. Antioxidant addition to buffers may be beneficial.

Researchers should validate protein purity (>85% by SDS-PAGE is standard) before experimental use and consider the production system (yeast expression systems are commonly used) when interpreting experimental results .

How might single-cell analysis techniques advance our understanding of NDUFB8 function in heterogeneous tissues?

Single-cell analysis techniques offer unprecedented opportunities to understand NDUFB8 function in heterogeneous tissues by revealing cell-specific variations in expression, post-translational modifications, and functional consequences. These approaches could help address current limitations in understanding tissue-specific manifestations of NDUFB8 mutations and their role in disease progression.

Emerging methodologies particularly relevant to NDUFB8 research include:

  • Single-cell respirometry: For measuring cell-specific mitochondrial respiratory capacity

  • Single-cell proteomics: To quantify NDUFB8 abundance and modifications at the individual cell level

  • Spatial transcriptomics: To map NDUFB8 expression patterns within tissues and correlate with functional markers

  • Mass cytometry (CyTOF): For simultaneous measurement of multiple mitochondrial proteins including NDUFB8

  • Live-cell imaging with NDUFB8-specific probes: To track real-time changes in localization and function

These approaches would be particularly valuable for understanding the cellular mosaic effect in mitochondrial diseases and could help explain why certain tissues are more affected by NDUFB8 mutations than others.

What are the implications of NDUFB8 nitration for developing mitochondrial-targeted therapeutics?

The finding that NDUFB8 nitration coincides with mitochondrial dysfunction and ultimately leads to necrotic cell death opens several avenues for therapeutic development:

  • Mitochondrial-targeted antioxidants: Since NDUFB8 nitration is dependent on mitochondrial superoxide generation, compounds that selectively scavenge mitochondrial ROS could prevent NDUFB8 nitration and preserve complex I function .

  • MnSOD mimetics: Overexpression of manganese superoxide dismutase (MnSOD) has been shown to reverse NO-induced NDUFB8 nitration, suggesting that synthetic MnSOD mimetics could have therapeutic potential .

  • RIP kinase inhibitors: Research has revealed that NO-induced caspase-independent cell death could be blocked by inhibiting RIP kinases, suggesting these as potential therapeutic targets for conditions involving NDUFB8 nitration .

  • Targeted protein replacement therapies: Development of methods to deliver functional NDUFB8 to affected tissues could potentially restore complex I activity in patients with NDUFB8 mutations .

  • Gene therapy approaches: The success of complementation studies with wild-type NDUFB8 suggests that gene therapy approaches targeting the NDUFB8 gene could be effective for treating complex I deficiency caused by NDUFB8 mutations .

Understanding the molecular mechanisms of NDUFB8 nitration and its consequences provides a framework for developing targeted interventions that could prevent or reverse mitochondrial dysfunction in various pathological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.