Recombinant Gorilla gorilla gorilla NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
MNFALILMTNTLLALLLMIITFWLPQLNSYMEKTNPYECGFDPVSPARIPFSMKFFLVAI TFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILTLSLAYEWLQKGLDWTE
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. This subunit is essential for the catalytic activity of Complex I.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what specific role does it play in mitochondrial function?

MT-ND3 (Mitochondrially encoded NADH:ubiquinone oxidoreductase chain 3) is a critical component of Complex I in the mitochondrial respiratory chain. Complex I catalyzes the transfer of electrons from NADH to ubiquinone coupled with proton translocation across the inner mitochondrial membrane.

The MT-ND3 gene encodes one of the seven mitochondrially-encoded subunits of Complex I, with the remaining subunits being nuclear-encoded and imported into the organelle from the cytoplasm . This protein plays an essential role in the energy-coupling mechanism where NADH oxidation by ubiquinone is linked to the translocation of 4 protons per pair of electrons transferred . This proton translocation contributes to generating the proton motive force (pmf) necessary for ATP synthesis.

How conserved is MT-ND3 across primate species and what does this tell us about its evolutionary importance?

Analysis of MT-ND3 sequences across primate species reveals important evolutionary patterns. Comparative genomic studies including humans, chimpanzees, and gorilla show differential patterns of conservation that suggest functional constraints on this gene.

Between humans and chimpanzees, researchers have identified 4 replacement (amino acid-changing) and 31 silent nucleotide differences in the ND3 gene . When comparing humans, chimpanzees, and gorilla, this expands to 7 replacement and 45 silent differences . This disproportionate ratio of silent to replacement substitutions between species indicates strong purifying selection, suggesting the critical functional importance of the MT-ND3 protein sequence.

Within species, the pattern differs significantly. Within humans and chimpanzees combined, there were 8 replacement and 10 silent differences . This higher proportion of replacement polymorphisms within species compared to fixed differences between species contradicts expectations under neutral evolution and suggests the action of selection pressures.

These conservation patterns reflect the essential role of MT-ND3 in mitochondrial energy production and suggest that most amino acid substitutions are not tolerated over evolutionary time.

What experimental approaches are most effective for sequencing gorilla MT-ND3?

Researchers have successfully employed several methodological approaches for sequencing gorilla MT-ND3:

  • PCR amplification using specific primers:

    • Successful primers included L10023 (17 mer), H10500 (25 mer), and H10195 (19 mer)

    • Primer sequences were based on reference sequences from Anderson et al. (1981)

    • Note that while H10353 worked for gorilla DNA, it failed with chimpanzee DNA, requiring substitution with H10354

  • Next-Generation Sequencing (NGS) approaches:

    • Modern NGS technologies allow individual sequencing of each template

    • This enables quantitative analysis of heteroplasmic mutant load by counting mtDNA reads

    • The sequenced reads can be mapped to reference sequences (such as NC_012920 for human mitochondria) using Burrows-Wheeler Aligner

    • Variants can be identified using the Genome Analysis Toolkit with appropriate quality filtering parameters

  • Analysis methodology:

    • Manual sequence alignment for comparative studies

    • Counting replacement and silent nucleotide substitutions

    • Calculation of nucleotide diversity (π) for each species

    • Application of McDonald-Kreitman tests to evaluate selective pressures

These approaches provide a comprehensive methodology for extracting and analyzing MT-ND3 sequence data from gorilla samples for both basic characterization and evolutionary studies.

What are the most challenging aspects of expressing recombinant gorilla MT-ND3 and how can researchers overcome them?

Expression of recombinant gorilla MT-ND3 presents several significant challenges due to its nature as a mitochondrial membrane protein:

  • Membrane protein expression challenges:
    As a component of Complex I embedded in the inner mitochondrial membrane, MT-ND3 is highly hydrophobic. Traditional expression systems often result in protein aggregation or improper folding. Researchers should consider specialized expression systems designed for membrane proteins, such as:

    • Cell-free expression systems with added lipids or detergents

    • Specialized bacterial strains with enhanced membrane protein expression capabilities

    • Yeast or mammalian cell systems that better replicate the eukaryotic folding environment

  • Functional context requirements:
    MT-ND3 naturally functions as part of a large multisubunit complex containing at least 41 subunits . Expression of the isolated subunit may not capture its native conformation or functionality. Approaches to address this include:

    • Co-expression with interacting subunits to form subcomplexes

    • Integration into nanodiscs or liposomes to provide a membrane environment

    • Use of specialized detergents that maintain native-like structural properties

  • Purification challenges:
    Once expressed, purification presents additional hurdles. Methodological solutions include:

    • Affinity tags positioned to avoid interfering with protein folding

    • Optimization of detergent types and concentrations for solubilization

    • Gradient purification techniques to separate properly folded protein from aggregates

    • Mass spectrometry verification similar to techniques used to identify novel Complex I subunits

  • Functional validation:
    Confirming that recombinant MT-ND3 retains native properties requires specialized assays:

    • Reconstitution experiments with other Complex I components

    • Activity assays using artificial electron acceptors such as ferricyanide, hexaammineruthenium (III), or DCIP

    • Conformational analysis methods to detect NADH-induced structural changes

How do researchers analyze the impact of specific mutations in MT-ND3 on Complex I function?

Analysis of MT-ND3 mutations requires a multifaceted approach combining genetic, biochemical, and clinical methods:

  • Genetic characterization:

    • Quantification of mutation heteroplasmy (percentage of mutated mtDNA)

    • In studies of human MT-ND3 mutations, mutations such as m.10191T>C showed mutant loads ranging from 57.9% to 93.6%, with a median of 82.5%

    • Statistical analysis of correlations between mutant load and phenotypes (e.g., Pearson correlation coefficients)

  • Functional assessments:

    • Measurement of Complex I enzymatic activities using various electron acceptors

    • Analysis of oxygen consumption rates in intact mitochondria or cells

    • Evaluation of proton translocation efficiency, critical since Complex I translocates 4 protons per pair of electrons transferred

    • Assessment of ROS production, as Complex I is a major site of superoxide generation

  • Structural impact analysis:

    • In silico modeling of mutation effects on protein structure

    • Experimental approaches such as limited proteolysis to detect conformational changes

    • Analysis of interaction with other Complex I subunits

  • Clinical correlation:

    • In human studies, MT-ND3 mutations (particularly m.10191T>C) have been associated with Leigh syndrome and epilepsy, including Lennox-Gastaut syndrome

    • Animal models expressing mutant MT-ND3 can provide insights into pathophysiological mechanisms

    • Response to therapeutic interventions (e.g., "mitochondrial cocktail treatment" including coenzyme Q10, L-carnitine, and multivitamins)

What methodologies provide the most robust analysis of evolutionary selection pressures on MT-ND3?

Several sophisticated methodological approaches can be employed to analyze selection pressures on MT-ND3:

  • McDonald-Kreitman test:
    This statistical test compares the ratio of replacement to silent nucleotide substitutions within and between species:

    • It tests the neutral expectation that this ratio should be the same within and between species

    • For ND3, this test has rejected the null hypothesis of strict neutrality

    • The test has strong theoretical support for using fixed differences between species

  • Comparative analysis of substitution patterns:

    • Within humans and chimpanzees: 8 replacement and 10 silent differences

    • Between humans and chimpanzees: 4 replacement and 31 silent differences

    • Among humans, chimpanzees, and gorilla: 7 replacement and 45 silent differences

    • This disproportionate pattern suggests purifying selection acting on replacement substitutions

  • Genome-wide comparative analysis:

    • Similar patterns have been observed across the entire mitochondrial genome

    • For the complete mtDNA, between humans and chimps, 179 of 1094 substitutions (16.4%) were at replacement sites

    • Among human, chimpanzee, and gorilla, 328 of 1881 (17.4%) were at replacement sites

    • These proportions are significantly lower than within-species patterns

  • Functional complex analysis:

    • Patterns of replacement and silent substitution can be analyzed separately for different functional complexes

    • This approach can identify whether selection pressures differ among mitochondrial genes with different functions

This methodological framework provides robust evidence that MT-ND3 evolution is shaped by purifying selection, with most amino acid changes being selected against over evolutionary time.

How does research on gorilla MT-ND3 contribute to our understanding of human mitochondrial diseases?

Comparative research on gorilla MT-ND3 provides valuable insights into human mitochondrial diseases through several mechanisms:

  • Identification of functionally critical regions:

    • Regions conserved across species likely represent functionally crucial domains

    • Mutations in these conserved regions in humans are more likely to cause disease

    • For example, the m.10191T>C mutation in human MT-ND3 associated with Leigh syndrome and epilepsy occurs in a region under evolutionary constraint

  • Understanding pathogenic mechanisms:

    • Comparing the effects of equivalent mutations across species helps elucidate pathogenic mechanisms

    • Six of seven patients with m.10191T>C mutation in MT-ND3 were diagnosed with epilepsy, with three developing Lennox-Gastaut syndrome (LGS)

    • This clinical pattern suggests specific functional consequences of disrupting this conserved region

  • Insights into compensatory mechanisms:

    • Variations that exist between species but not within humans might represent changes that require compensatory mutations

    • Identifying these compensatory mechanisms could guide therapeutic approaches

  • Evolutionary perspective on disease susceptibility:

    • The higher ratio of replacement to silent mutations within humans compared to between-species differences suggests many variants may be slightly deleterious

    • This pattern helps explain the prevalence of mitochondrial diseases in human populations

  • Potential treatment targets:

    • Conserved functional domains identified through comparative studies represent potential therapeutic targets

    • Current treatments for MT-ND3-related conditions include "mitochondrial cocktail" therapies with coenzyme Q10, L-carnitine, and multivitamins

What insights have researchers gained about the structure-function relationship of MT-ND3 through comparative studies?

Comparative studies across primate species have revealed important insights into MT-ND3 structure-function relationships:

  • Functional constraints on sequence evolution:

    • The disproportionate ratio of silent to replacement substitutions between species (45 silent vs. 7 replacement among humans, chimpanzees, and gorilla) indicates strong functional constraints

    • This pattern suggests that most amino acid changes disrupt protein function and are selected against

  • Complex I assembly and stability:

    • MT-ND3 is a critical component of Complex I, which contains at least 41 subunits in bovine heart mitochondria

    • Comparative studies help identify residues important for proper assembly and stability of this massive complex

  • Energy coupling mechanism:

    • MT-ND3 likely participates in the energy-coupling mechanism of Complex I

    • This mechanism involves the translocation of 4 protons per pair of electrons transferred from NADH to ubiquinone

    • Conserved residues likely play roles in this proton translocation process

  • Conformational dynamics:

    • NADH-induced conformational changes have been demonstrated in Complex I

    • Comparative studies help identify residues involved in these conformational changes

    • These dynamics may involve "energy-coupled redox-dependent substrate/product binding/release conformational change mechanism"

  • Pathogenic mutation patterns:

    • Research on human MT-ND3 mutations shows clustering in functionally important regions

    • For example, the m.10191T>C and m.10158T>C mutations are associated with Leigh syndrome and epilepsy

    • These pathogenic sites likely represent functionally critical residues conserved across primates

How can researchers design experiments to study the integration of recombinant gorilla MT-ND3 into functional Complex I?

Designing experiments to study recombinant gorilla MT-ND3 integration into functional Complex I requires sophisticated approaches:

  • Expression system selection:

    • Mammalian expression systems may provide the most appropriate cellular environment

    • MT-ND3 is normally encoded in mitochondrial DNA, requiring specialized constructs for expression

    • Expression may need to be targeted to mitochondria for proper integration

  • Complex I reconstitution approaches:

    • Purification of other Complex I components for in vitro reconstitution experiments

    • Electrospray mass spectrometry can be used to verify proper integration, similar to techniques used to identify novel Complex I subunits

    • Two-dimensional polyacrylamide gel electrophoresis can separate and identify complex components

  • Functional assays:

    • NADH oxidase or NADH:ubiquinone reductase activity measurements

    • Comparison with various artificial electron acceptors including:

      • Ferricyanide

      • Hexaammineruthenium (III) (HAR)

      • DCIP (2,6-dichloroindophenol)

      • Menadione

      • Cytochrome c

      • Acetyl-NAD+ (transhydrogenase reaction)

      • Oxygen (for superoxide generation)

  • Proton translocation assays:

    • Measurement of proton translocation efficiency

    • Testing the stoichiometry of 4 protons per pair of electrons transferred

    • Evaluation of the coupling between electron transfer and proton translocation

  • Conformational change analysis:

    • Studies to detect NADH-induced conformational changes in the complex

    • Evaluation of how these conformational changes contribute to the energy transduction mechanism

    • Comparison with native Complex I to assess functional fidelity

  • Mutational analysis:

    • Introduction of specific mutations found in human pathologies or unique to gorilla

    • Assessment of how these mutations affect assembly, stability, and function

    • Correlation with clinical presentations in human MT-ND3 mutations

This experimental framework provides a comprehensive approach to understanding the integration and function of recombinant gorilla MT-ND3 in the context of Complex I.

How should researchers interpret heteroplasmy data in experimental studies with recombinant MT-ND3?

Heteroplasmy—the presence of multiple mitochondrial DNA variants within a single cell or individual—is a critical factor in MT-ND3 research that requires sophisticated analysis:

  • Quantification methodologies:

    • Next-generation sequencing (NGS) allows precise quantification of heteroplasmic variants

    • "Each template is sequenced individually; therefore, quantitative analysis of the heteroplasmic mutant load is possible by counting the number of mtDNA reads"

    • Variant identification using tools like the Genome Analysis Toolkit with appropriate quality filters

  • Threshold effects interpretation:

    • In human MT-ND3 mutation studies, the mutant load of m.10191T>C ranged from 57.9% to 93.6% with a median of 82.5%

    • Analysis should consider potential threshold effects, where symptoms appear only above certain heteroplasmy levels

    • Statistical approaches can assess correlations between mutant load and phenotype severity

  • Tissue-specific variations:

    • Heteroplasmy levels often vary between tissues

    • Experimental design should account for tissue-specific effects

    • For recombinant studies, controlled heteroplasmy levels can be created to study threshold effects

  • Correlation analysis approaches:

    • Pearson correlation coefficients can assess relationships between:

      • Mutant load and age of symptom onset

      • Mutant load and disease severity

      • Mutant load and specific clinical features

    • In human studies, correlation analysis between MT-ND3 mutant load and disease phenotypes yielded correlation coefficients ranging from r=0.374 to r=0.523

  • Evolutionary interpretation:

    • Within-species variation in MT-ND3 shows higher rates of replacement variants compared to between-species fixed differences

    • This suggests many heteroplasmic variants may be mildly deleterious

    • Experimental studies should consider this evolutionary context when interpreting heteroplasmy data

What statistical approaches are most appropriate for analyzing evolutionary patterns in MT-ND3 across primate species?

Several sophisticated statistical approaches have proven effective for analyzing evolutionary patterns in MT-ND3:

  • McDonald-Kreitman test:

    • Tests whether the ratio of replacement to silent substitutions is the same within and between species

    • For MT-ND3, this test has rejected the neutral model of evolution

    • Fisher's exact tests can be used to evaluate statistical significance of differences in substitution patterns

  • Nucleotide diversity calculations:

    • Calculation of nucleotide diversity (π) for each species provides a measure of genetic variation

    • This can be separately calculated for replacement and silent sites

    • Comparisons across species reveal different levels of constraint

  • Ratio analysis of substitution types:

    • Within humans and chimpanzees: 8 replacement and 10 silent differences (44.4% replacement)

    • Between humans and chimpanzees: 4 replacement and 31 silent differences (11.4% replacement)

    • Among humans, chimpanzees, and gorilla: 7 replacement and 45 silent differences (13.5% replacement)

    • Statistical comparison of these ratios reveals evolutionary patterns

  • Genome-wide comparative analysis:

    • Patterns observed in MT-ND3 can be compared to other mitochondrial genes

    • Between humans and chimps across all mtDNA: 179 of 1094 substitutions (16.4%) at replacement sites

    • Among human, chimpanzee, and gorilla across all mtDNA: 328 of 1881 (17.4%) at replacement sites

    • Statistical tests can determine if MT-ND3 shows significantly different patterns

  • Complex-specific analysis:

    • Separate analysis of different functional complexes (e.g., cytochrome oxidase genes vs. NADH dehydrogenase genes)

    • This approach can identify whether selection pressures differ among genes with different functions

    • Statistical comparison can determine if differences are significant

What are the key experimental controls needed when studying recombinant gorilla MT-ND3 in heterologous expression systems?

Rigorous experimental controls are essential when studying recombinant gorilla MT-ND3:

  • Expression controls:

    • Empty vector controls to assess background activity

    • Wild-type human MT-ND3 expression as a reference point

    • Expression level quantification via western blotting or mass spectrometry

    • Subcellular localization verification to confirm proper targeting

  • Functional controls:

    • Comparison with native Complex I isolated from gorilla mitochondria when possible

    • Assessment of assembly into the complete Complex I structure

    • Controls with known inactive mutants to establish assay dynamic range

    • Comparison of activity with different electron acceptors to characterize functional profiles

  • Species comparison controls:

    • Parallel expression of human and chimpanzee MT-ND3 for comparative analysis

    • This is particularly important given the known differences in ND3 sequences across these species

    • Such comparisons can identify species-specific functional properties

  • Mutation controls:

    • Site-directed mutagenesis to introduce known pathogenic mutations

    • For example, creating the m.10191T>C mutation found in human Leigh syndrome patients

    • These serve as positive controls for functional disruption

    • Introduction of neutral variants (based on evolutionary data) as negative controls

  • Activity specificity controls:

    • Inhibitor controls using Complex I-specific inhibitors like rotenone

    • Measurement of "rotenone-insensitive 'diaphorase' activities" as described in the literature

    • This helps distinguish specific Complex I activity from non-specific NADH oxidation

  • Data validation controls:

    • Technical replicates to assess measurement precision

    • Biological replicates to account for expression variability

    • Multiple methodological approaches to confirm findings

    • Statistical analysis with appropriate tests to ensure significance

These comprehensive controls ensure the validity and interpretability of experimental results with recombinant gorilla MT-ND3.

What emerging technologies might advance our understanding of gorilla MT-ND3 structure and function?

Several cutting-edge technologies hold particular promise for advancing MT-ND3 research:

  • Cryo-electron microscopy (cryo-EM):

    • High-resolution structural determination of Complex I with gorilla MT-ND3

    • Visualization of conformational changes during the catalytic cycle

    • Comparison of structures with different species' MT-ND3 variants

  • Advanced protein expression systems:

    • Cell-free expression systems optimized for membrane proteins

    • Nanodiscs and other membrane mimetics for functional reconstitution

    • Mitochondrially-targeted expression systems for in situ incorporation

  • Single-molecule techniques:

    • FRET-based approaches to monitor conformational dynamics

    • Optical tweezers to measure force generation by Complex I

    • These techniques could provide insights into the "energy-coupled redox-dependent substrate/product binding/release conformational change mechanism" proposed for Complex I

  • Long-read sequencing technologies:

    • Improved analysis of MT-ND3 in the context of complete mitochondrial genomes

    • Better detection and quantification of heteroplasmy

    • More comprehensive population genetic analyses across primates

  • CRISPR-based mitochondrial DNA editing:

    • Precise introduction of MT-ND3 variants into cellular models

    • Creation of isogenic cell lines differing only in MT-ND3 sequence

    • Development of animal models with specific MT-ND3 variants

  • Computational approaches:

    • Molecular dynamics simulations of MT-ND3 within Complex I

    • Machine learning algorithms to predict functional impacts of variants

    • Evolutionary analyses integrating structural and functional data

How might comparative studies of MT-ND3 across different great ape species contribute to mitochondrial disease research?

Comparative studies across great apes offer unique opportunities for advancing mitochondrial disease research:

  • Natural experiments in tolerance:

    • Identification of variants that are pathogenic in humans but normal in other great apes

    • These may reveal compensatory mechanisms that could be therapeutic targets

    • Analysis of sequence differences between humans and great apes may explain human-specific disease susceptibilities

  • Evolutionary medicine insights:

    • The higher ratio of replacement to silent mutations within species compared to between-species differences suggests many variants may be slightly deleterious

    • This helps explain why mitochondrial diseases persist in human populations

    • Comparing this pattern across great apes may reveal differences in selective pressures

  • Functional domain mapping:

    • Regions conserved across all great apes likely represent functionally critical domains

    • Mutations in these regions in humans (such as m.10191T>C and m.10158T>C associated with Leigh syndrome) are likely pathogenic

    • This approach can help prioritize variants of uncertain significance in human patients

  • Complex I assembly and stability:

    • Differences in MT-ND3 across great apes may affect Complex I assembly or stability

    • These could inform therapeutic approaches aimed at stabilizing Complex I in patients with mitochondrial diseases

    • Species differences may reveal flexibility in assembly pathways

  • Heteroplasmy tolerance mechanisms:

    • Different great ape species may have different tolerance thresholds for heteroplasmic mutations

    • In human studies, MT-ND3 mutations such as m.10191T>C showed mutant loads ranging from 57.9% to 93.6%

    • Comparative studies could reveal mechanisms that modulate heteroplasmy threshold effects

What are the most promising approaches for developing in vitro functional assays for recombinant MT-ND3?

Development of robust functional assays for recombinant MT-ND3 requires innovative approaches:

  • Reconstitution strategies:

    • Assembly of MT-ND3 with other Complex I components

    • Stepwise reconstitution to identify minimal functional units

    • Verification of assembly using techniques like electrospray mass spectrometry and two-dimensional gel electrophoresis

  • Electron transfer activity assays:

    • NADH oxidation coupled to various electron acceptors:

      • Natural substrate: ubiquinone

      • Artificial acceptors: ferricyanide, hexaammineruthenium (III), DCIP, menadione, cytochrome c

    • Measurement of activity rates under various conditions

    • Inhibitor sensitivity assays (e.g., rotenone sensitivity)

  • Proton translocation measurements:

    • Assays to measure the proton translocation stoichiometry (4 protons per pair of electrons)

    • pH-sensitive fluorescent probes in reconstituted proteoliposomes

    • Patch-clamp techniques for direct measurement of proton currents

  • Conformational change assays:

    • Detection of NADH-induced conformational changes

    • Fluorescence-based approaches to monitor structural dynamics

    • Biophysical techniques such as circular dichroism or FTIR spectroscopy

  • Integration with emerging technologies:

    • Label-free biosensors for real-time activity monitoring

    • Microfluidic systems for high-throughput screening of conditions or variants

    • Combination with cryo-EM for structure-function correlation

  • Mutational scanning approaches:

    • Systematic introduction of mutations to map functional domains

    • Comparison with known pathogenic mutations such as m.10191T>C and m.10158T>C

    • Correlation of functional impacts with evolutionary conservation patterns

These approaches collectively provide a comprehensive toolkit for functional characterization of recombinant gorilla MT-ND3, advancing both basic science and potential therapeutic applications for mitochondrial diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.