Recombinant Gorilla gorilla gorilla Olfactory receptor 1A1 (OR1A1)

What is Gorilla gorilla gorilla Olfactory Receptor 1A1 and how does it compare to its human ortholog?

Gorilla gorilla gorilla Olfactory Receptor 1A1 (OR1A1) is a G-protein-coupled receptor belonging to the largest transmembrane protein family in the gorilla genome. Like its human ortholog, it functions in detecting odorant molecules in the environment. OR1A1 from Western lowland gorilla consists of 309 amino acids and shares significant structural similarities with human OR1A1, though specific binding properties may differ due to evolutionary adaptations . The human OR1A1 has been shown to respond to specific odorants such as dihydrojasmone with micromolar affinity, and molecular modeling studies suggest similar binding characteristics in the gorilla variant .

What are the optimal storage and handling conditions for recombinant gorilla OR1A1?

Recombinant gorilla OR1A1 is typically supplied as a lyophilized powder and requires careful handling to maintain its structural integrity. For long-term storage, the protein should be kept at -20°C or -80°C. When preparing working solutions, it is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Adding glycerol to a final concentration of 5-50% (optimally 50%) helps prevent degradation during freeze-thaw cycles. After reconstitution, working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided . For detergent-solubilized preparations, buffer composition is critical for maintaining the native conformation of the receptor.

What methodological approaches are most effective for determining the three-dimensional structure of gorilla OR1A1?

Determining the structure of membrane proteins like OR1A1 presents significant challenges. For gorilla OR1A1, a multi-faceted approach is recommended. Initially, homology modeling using templates from related G-protein-coupled receptors provides a computational starting point . Tools like Bio-GATS can help select appropriate templates based on hydrophobicity correspondence, resolution, and binding pocket similarity . For experimental structure determination, purification of sufficient quantities of properly folded protein is crucial, requiring optimization of expression systems and purification protocols similar to those used for human OR1A1 .

Size exclusion chromatography combined with multi-angle light scattering can be employed to isolate monomeric and dimeric forms, which have shown different functional properties in human OR1A1 . Circular dichroism spectroscopy should be used to verify proper folding before attempting crystallization or other structural studies . For higher-resolution studies, techniques such as X-ray crystallography or cryo-electron microscopy may be applicable once sufficient pure, stable protein is obtained.

How can site-directed mutagenesis be applied to understand the functional properties of gorilla OR1A1?

Site-directed mutagenesis is a powerful approach for understanding structure-function relationships in OR1A1. Based on studies with human OR1A1, researchers should target conserved residues within the orthosteric binding pocket, particularly positions 3.36, 3.37, 3.40, 4.56, and 5.46, which have been implicated in ligand binding . A systematic mutagenesis strategy should include:

• Selection of target residues based on sequence alignment with human OR1A1 and computational docking studies

• Generation of single-point mutants using standard molecular biology techniques

• Expression of mutant receptors in functional assay systems (e.g., HEK293S cells)

• Evaluation of receptor function using real-time cAMP assays or calcium imaging

• Determination of binding affinities using intrinsic tryptophan fluorescence assays

This approach can identify critical residues involved in ligand recognition and receptor activation, providing insights into the molecular mechanisms underlying olfactory perception in gorillas compared to humans .

What purification strategies yield the highest quality recombinant gorilla OR1A1 for structural studies?

Based on successful purification of human OR1A1, a two-step purification strategy is recommended for gorilla OR1A1:

Purification Protocol:

• Express gorilla OR1A1 with appropriate epitope tags (e.g., N-terminal His-tag or dual FLAG-rho1D4 tags) in the chosen expression system (E. coli or HEK293S cells)

• Extract the receptor using appropriate detergents that maintain protein folding

• Perform initial purification using affinity chromatography (e.g., Ni-NTA for His-tagged protein or anti-FLAG immunoaffinity purification)

• Further purify using size exclusion chromatography to separate monomeric and dimeric forms

• Verify purity using SDS-PAGE (target >90% purity)

• Confirm proper folding using circular dichroism spectroscopy

This approach has yielded approximately 1.6 mg of monomeric and 1.1 mg of dimeric forms of human OR1A1 from sixty T175 flasks, and similar yields might be expected for gorilla OR1A1 with appropriate optimization .

How can ligand binding assays be optimized for recombinant gorilla OR1A1?

Optimizing ligand binding assays for gorilla OR1A1 requires careful consideration of receptor stability and detection methods:

Recommended Binding Assay Procedure:

• Use detergent-solubilized purified receptor maintained in a buffer containing stabilizing agents

• For intrinsic tryptophan fluorescence assays (as used with human OR1A1), optimize excitation wavelength (typically ~280 nm) and measure emission at ~320-350 nm

• Prepare serial dilutions of potential ligands (e.g., dihydrojasmone, citronellol, carvone isomers) in appropriate solvent

• Measure fluorescence changes upon ligand addition

• Plot concentration-response curves to determine binding affinity (Kd)

• Include appropriate controls (denatured receptor, non-cognate ligands)

For functional assays, heterologous expression systems coupled with real-time cAMP measurement or calcium imaging can be employed to assess receptor activation by potential ligands . These methods allow for determination of both binding affinity and efficacy, providing a more complete picture of ligand-receptor interactions.

What are the key structural domains of gorilla OR1A1 and their functional significance?

Gorilla OR1A1, like other class A GPCRs, contains several functionally important domains:

The complete amino acid sequence of gorilla OR1A1 (MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVHLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLSGSKSISFGGCLTQMYFMIDLGNTDSYTLAAMAYDRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGMYFRPLTNYSLKDAVITVMCTAVTPMLNPFIYSLRNRDMKAALQKLFNKRISS) shows high conservation with human OR1A1, suggesting similar structural organization and function .

How does dimerization affect the functional properties of gorilla OR1A1?

Based on studies of human OR1A1, which exists in both monomeric and dimeric forms, dimerization likely plays a significant role in gorilla OR1A1 function . Size exclusion chromatography-multi-angle light scattering analysis of human OR1A1 revealed distinct monomeric and dimeric populations . While specific data for gorilla OR1A1 dimerization is limited, several hypotheses can be proposed based on related GPCRs:

• Dimerization may alter ligand binding properties by creating new binding interfaces or changing the conformation of existing binding pockets

• Dimeric forms may couple differently to G proteins, potentially activating different signaling pathways

• Dimerization could affect receptor trafficking and localization within cells

• The equilibrium between monomeric and dimeric forms may be regulated by ligand binding

Investigating the functional differences between monomeric and dimeric forms of gorilla OR1A1 would provide valuable insights into the molecular mechanisms of olfactory signal transduction in primates.

What evolutionary insights can be gained from comparing gorilla OR1A1 with orthologs from other primates?

Comparative analysis of OR1A1 across primate species can provide valuable insights into olfactory evolution and adaptation:

• Sequence conservation analysis between gorilla OR1A1 and orthologs from humans, chimpanzees, and other primates can identify highly conserved regions essential for basic receptor function versus variable regions that may confer species-specific odorant preferences .

• Differential selection pressure on specific amino acid positions may correlate with ecological niches and dietary adaptations of different primate species.

• Functional characterization of OR1A1 from different species using the same set of odorants can reveal shifts in receptor tuning that occurred during primate evolution.

• Comparison of expression patterns across species may indicate differential importance of OR1A1-mediated olfaction in various ecological contexts.

This evolutionary perspective can contribute to our understanding of how sensory systems adapted during primate evolution and potentially inform studies on human olfactory dysfunction.

What insights can gorilla OR1A1 provide into the evolution of olfactory perception in primates?

Studying gorilla OR1A1 in comparison with human and other primate orthologs can provide several important evolutionary insights:

• The degree of conservation in binding pocket residues can indicate the evolutionary importance of detecting specific odorants across primate lineages.

• Differences in ligand specificity between gorilla and human OR1A1 may correspond to ecological adaptations, such as food preference or predator detection.

• The presence of gorilla OR1A1 in non-olfactory tissues (similar to human OR1A1's ectopic expression in enterochromaffin cells and liver cells) could suggest conserved non-olfactory functions that emerged before the human-gorilla evolutionary split .

• Comparison of genetic variation in OR1A1 across gorilla populations may reveal ongoing selection pressures and adaptations to different environments.

These insights contribute to our understanding of sensory biology evolution and may have implications for interpreting human olfactory diversity and dysfunction.

How can computational approaches be applied to predict ligand interactions with gorilla OR1A1?

Computational approaches offer powerful tools for predicting gorilla OR1A1-ligand interactions:

• Homology Modeling: Using the Bio-GATS approach or similar methods, researchers can generate 3D structural models of gorilla OR1A1 based on template structures from related GPCRs . Optimal templates for OR1A1 modeling include human NK-1 receptor (PDB: 6HLP), bovine rhodopsin (PDB: 1U19), and human thromboxane A2 receptor (PDB: 6IIU) .

• Molecular Docking: Once a reliable model is established, potential ligands can be docked to identify key interaction sites and binding energies. For OR1A1, this approach has successfully identified interactions between human OR1A1 and several ligands .

• Molecular Dynamics Simulations: These can model the dynamic behavior of the receptor-ligand complex over time, providing insights into binding stability and conformational changes associated with receptor activation.

• Quantitative Structure-Activity Relationship (QSAR) Analysis: By correlating molecular properties of ligands with their binding affinities or activation potencies, QSAR can predict the activity of novel compounds.

• Molecular Vibration Analysis: The revised corralled intensity of molecular vibrational frequency (CIMVF) has been applied to characterize OR1A1 ligands, offering additional perspectives on structure-activity relationships .

These computational methods can guide experimental design and provide hypotheses about gorilla OR1A1 function that can be tested experimentally.

What are the current limitations in gorilla OR1A1 research and how might they be addressed?

Current limitations in gorilla OR1A1 research include:

• Limited direct experimental data: Most insights are extrapolated from human OR1A1 studies or computational predictions rather than direct experimental characterization of the gorilla receptor .

• Technical challenges in membrane protein expression and purification: Obtaining sufficient quantities of properly folded receptor remains difficult, limiting structural and biochemical studies .

• Lack of native tissue studies: Most research uses recombinant systems, which may not fully recapitulate the receptor's behavior in its native environment.

• Limited understanding of in vivo function: The ecological significance of OR1A1 in gorilla olfaction remains largely unexplored.

To address these limitations, researchers could:

• Develop improved expression systems specifically optimized for gorilla OR1A1

• Apply emerging structural biology techniques such as cryo-EM to determine the receptor's structure

• Conduct comparative functional studies across multiple primate OR1A1 orthologs

• Investigate OR1A1 expression patterns in gorilla olfactory tissues and potential non-olfactory sites

• Develop animal models expressing gorilla OR1A1 to study its function in more complex systems