Recombinant Gorilla gorilla gorilla Potassium voltage-gated channel subfamily S member 1 (KCNS1)

Shipped with Ice Packs
In Stock

Description

Introduction to KCNS1

Potassium voltage-gated channel subfamily S member 1 (KCNS1) belongs to a diverse family of potassium channels critical for cellular function. This protein, specifically derived from Gorilla gorilla gorilla (Western lowland gorilla), functions as a modulatory subunit in voltage-gated potassium channels present in the brain . KCNS1 is also known by alternative names including Delayed-rectifier K(+) channel alpha subunit 1 and Voltage-gated potassium channel subunit Kv9.1 . The recombinant form of this protein has been developed to facilitate research into ion channel properties and neurological function.

Significance in Research

KCNS1 plays a crucial role in modulating neuronal excitability and has been implicated in various neurological processes. Research indicates that inflammation can alter the expression of neuronal potassium channel subunit mRNAs, including KCNS1 . This finding suggests potential roles for KCNS1 in neuroinflammatory processes and related disorders. The recombinant form of this protein enables researchers to study these processes in controlled laboratory settings without requiring direct extraction from gorilla tissues.

Development of Recombinant KCNS1

The recombinant version of Gorilla KCNS1 is produced using E. coli expression systems, allowing for consistent quality and characteristics suitable for research applications . Through these expression systems, researchers can obtain purified protein with properties closely resembling those of the native protein while maintaining ethical research standards.

Expression System and Production

Recombinant KCNS1 is expressed in E. coli systems with an N-terminal His-tag to facilitate purification . The protein spans the full length (amino acids 1-526) of the native sequence, ensuring complete functional representation . The E. coli expression system allows for efficient production of the protein in quantities suitable for research applications.

Functional Roles of KCNS1

KCNS1 functions as a modulatory subunit in voltage-gated potassium channels, contributing to the regulation of neuronal excitability and action potential duration.

Physiological Function

Voltage-gated potassium channels play critical roles in repolarizing the cell membrane after an action potential, thereby regulating neuronal excitability. KCNS1, as a modulatory subunit, can influence the properties of these channels, affecting their voltage sensitivity, activation kinetics, and conductance properties. These functions make KCNS1 an important component in the fine-tuning of neuronal signaling.

Role in Neurological Processes

Research has shown that KCNS1 is present in the brain, where it contributes to the modulation of neuronal activity . Moreover, evidence suggests that inflammation can alter the expression of KCNS1 mRNA, indicating its potential involvement in neuroinflammatory processes . This finding has implications for understanding how inflammatory conditions might affect neuronal function through changes in potassium channel activity.

Comparative Analysis with Other Species

Understanding the similarities and differences between KCNS1 proteins from different species can provide insights into evolutionary conservation and functional significance of specific regions.

Comparison with Colobus guereza KCNS1

The Colobus guereza (Mantled guereza) version of KCNS1 shares significant similarities with the Gorilla gorilla gorilla version, reflecting evolutionary conservation of this important channel protein . The Colobus guereza KCNS1 consists of 529 amino acids compared to the 526 amino acids in the gorilla version . This slight difference in length suggests potential functional adaptations specific to each species.

Evolutionary Conservation

The high degree of conservation in KCNS1 across primate species suggests its fundamental importance in neuronal function. Comparing these sequences can highlight regions that are critical for function (highly conserved) versus those that may allow for species-specific adaptations (more variable). This comparative approach enhances our understanding of structure-function relationships in voltage-gated potassium channels.

Table 2: Comparison of KCNS1 Characteristics Between Species

FeatureGorilla gorilla gorillaColobus guereza
Protein Length526 amino acids529 amino acids
UniProt IDA4K2R3A4K2P6
Expression SystemE. coliE. coli
TagN-terminal His-tagN-terminal His-tag

This comparison highlights both similarities and subtle differences between these closely related species, providing context for understanding the evolutionary conservation of KCNS1 .

Research Applications and Significance

Recombinant KCNS1 from Gorilla gorilla gorilla has several important research applications in neuroscience and pharmacology.

Neuroscience Research

The availability of purified recombinant KCNS1 enables detailed studies of potassium channel structure, function, and regulation. Researchers can use this protein to investigate how KCNS1 interacts with other channel subunits, how it responds to various stimuli, and how mutations might affect its function. These studies contribute to our understanding of neuronal excitability and signaling.

Implications in Neuroprotection Studies

Research has indicated that voltage-gated potassium channels, including KCNS1, may be involved in neuroprotective mechanisms. Studies examining resveratrol supplementation have found that it can affect the expression of potassium channel genes, suggesting potential therapeutic applications in conditions involving cerebral vascular dysfunction . The availability of recombinant KCNS1 facilitates further investigation into these neuroprotective mechanisms.

Reconstitution Protocol

For optimal results, it is recommended that the vial containing lyophilized KCNS1 be briefly centrifuged prior to opening to bring the contents to the bottom . The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . To enhance stability during long-term storage, addition of 5-50% glycerol (final concentration) is recommended, with 50% being the default concentration suggested for standard applications .

Future Research Directions

The study of recombinant Gorilla gorilla gorilla KCNS1 opens several avenues for future research in neuroscience and comparative biology.

Structure-Function Analysis

Further research into the three-dimensional structure of KCNS1 and how it relates to function could provide valuable insights into voltage-gated potassium channel operation. Techniques such as X-ray crystallography or cryo-electron microscopy could be employed to elucidate these structural details.

Therapeutic Potential

Given the involvement of potassium channels in various neurological disorders, research into KCNS1 function could contribute to the development of novel therapeutic approaches. Understanding how this channel subunit affects neuronal excitability could inform strategies for treating conditions characterized by abnormal neuronal activity.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type in mind, please communicate it to us, and we will prioritize its development.
Synonyms
KCNS1; Potassium voltage-gated channel subfamily S member 1; Delayed-rectifier K(+ channel alpha subunit 1; Voltage-gated potassium channel subunit Kv9.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-526
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
KCNS1
Target Protein Sequence
MLMLLVRGTHYENLRSKVVLPTPLAGRSTETFVSEFPGPDTGIRWRRSDEALRVNVGGVR RQLSARALARFPGTRLGRLHAAASEEQARRLCDDYDEAAREFYFDRHPGFFLSLLHFYRT GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPC PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGKEFGHLGKVVQVFRLMRIFRVLKLARHST GLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTVSMT TVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHR EFEDLLSSVDGVSEASLETSGETSQEGRSADLESQAPSEPPHPQRY
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It can form functional heterotetrameric channels in conjunction with KCNB1 and KCNB2, modulating the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1 and KCNB2.
Database Links
Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.1/KCNS1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is KCNS1 and what is its primary function in cellular physiology?

KCNS1 (potassium voltage-gated channel modifier subfamily S member 1) belongs to the S subfamily of the potassium channel family and represents a significant component in cellular electrophysiology. The protein functions as a modifier subunit within the voltage-gated potassium channel complex, though it is not functional by itself. Rather than forming functional homomeric channels, KCNS1 forms heteromultimers with members of the Shab-related subfamily of potassium voltage-gated channel proteins, particularly member 1 and member 2, thereby modulating their activity . Voltage-gated potassium channels constitute the largest and most diversified class of ion channels, found in both excitable and non-excitable cells. Their primary functions involve regulating the resting membrane potential and controlling the shape and frequency of action potentials, which is critical for normal neuronal function and cellular communication .

How is the Gorilla gorilla gorilla KCNS1 protein structurally characterized?

The recombinant Gorilla gorilla gorilla KCNS1 protein is a full-length transmembrane protein consisting of 526 amino acid residues . The protein sequence begins with MLMLLVRGTHYENLRSK and continues through multiple functional domains characteristic of voltage-gated potassium channels . This protein contains an N-terminal 10xHis-tag added for purification and detection purposes . Structurally, KCNS1 belongs to the voltage-gated potassium channel family and shares the characteristic architecture including transmembrane segments that form the ion conduction pathway and voltage-sensing domains. The protein is also referred to as Delayed-rectifier K(+) channel alpha subunit 1 or Voltage-gated potassium channel subunit Kv9.1, reflecting its functional classification within the broader potassium channel family .

What is the genomic context of the KCNS1 gene?

While the search results do not provide specific information about the gorilla KCNS1 genomic context, data from the human ortholog indicates that KCNS1 is located on chromosome 20 at position q13.12 . In humans, the gene spans the genomic region from position 45,091,214 to 45,101,127 on the complement strand (NC_000020.11) . The gene structure includes 5 exons, which is relatively compact compared to some other ion channel genes . Understanding this genomic organization is important for researchers investigating regulatory elements, splice variants, or designing gene-editing approaches. The conservation of genomic structure between species can provide insights into evolutionary constraints on this important channel modifier.

How does KCNS1 modulate the electrophysiological properties of functional potassium channels?

KCNS1, as a silent alpha subunit, exerts its regulatory effects through heteromultimerization with functional potassium channels, particularly those in the Shab-related subfamily . While not directly comparable, insights from related potassium channel modulatory subunits such as KCNE1 suggest complex mechanisms. KCNE1, for instance, remodels the voltage sensor of Kv7.1 channels, affecting the voltage dependence of channel activation . The modulatory mechanism likely involves direct interaction with the voltage-sensing domain (VSD) of the functional channel partners . In voltage-gated potassium channels, the N-terminal half (S4-N) and C-terminal half (S4-C) of the S4 segment contain basic residues that stabilize the resting and activated states, respectively . KCNS1 likely influences these interactions, altering gating kinetics, voltage sensitivity, or channel conductance. These modulatory effects are crucial for fine-tuning neuronal excitability and action potential characteristics in specific cellular contexts.

What evolutionary insights can be gained from studying Gorilla gorilla gorilla KCNS1 compared to human KCNS1?

Comparative analysis of Gorilla gorilla gorilla KCNS1 and human KCNS1 provides valuable evolutionary insights into potassium channel function across primates. The availability of recombinant Gorilla KCNS1 (UniProt: A4K2R3) enables direct structural and functional comparisons with human orthologs . Sequence conservation analysis between these closely related species can identify highly conserved functional domains that have been maintained through evolutionary pressure, suggesting critical roles in channel function. Conversely, regions with higher sequence divergence may indicate species-specific adaptations or relaxed functional constraints. Functional studies comparing the modulatory effects of gorilla KCNS1 versus human KCNS1 on identical partner channels could reveal subtle but potentially important species-specific differences in neuronal excitability regulation. Such evolutionary comparisons might illuminate the molecular basis for species differences in neurophysiology or susceptibility to disorders involving neuronal excitability.

What is known about KCNS1's role in disease pathophysiology and its potential as a therapeutic target?

While the search results don't provide specific information about KCNS1's role in disease, research on potassium channels broadly indicates their importance in multiple pathological conditions. The human KCNS1 gene has been associated with neuropathic pain sensitivity and potentially with bipolar disorder, as suggested by the mention of "seasonal pattern mania" in the search results . As a modulator of neuronal excitability, alterations in KCNS1 function could contribute to disorders characterized by abnormal neuronal firing patterns. Mechanistically, KCNS1's role as a modifier subunit suggests that its dysfunction might manifest more subtly than mutations in pore-forming channel subunits, potentially causing dysregulation of excitability rather than complete loss of channel function. The development of therapeutic approaches targeting KCNS1 would need to consider its modulatory role and the potential for off-target effects on related potassium channels. Comparative studies using the gorilla KCNS1 might provide insights into primate-specific aspects of channel modulation relevant to human disease mechanisms.

How can structural studies of KCNS1 inform rational drug design for potassium channel modulators?

Structural studies of KCNS1, facilitated by the availability of recombinant protein, can significantly advance rational drug design for potassium channel modulators. While KCNS1 itself is not functional alone, understanding its structure provides insights into how modifier subunits interact with and regulate functional potassium channels . High-resolution structural data could reveal binding interfaces between KCNS1 and its partner channels, identifying potential pockets for small molecule modulators. The availability of the full-length recombinant gorilla KCNS1 protein enables techniques such as X-ray crystallography, cryo-electron microscopy, or NMR studies to elucidate these structural details . Drug design strategies might target either the KCNS1 protein directly or the interaction interfaces between KCNS1 and its functional partners. Comparative structural analysis between gorilla and human KCNS1 could additionally highlight conserved pockets most suitable for therapeutic targeting across primates, potentially streamlining translational research from animal models to human applications.

What are the optimal storage and handling conditions for recombinant KCNS1 protein?

The recombinant Gorilla gorilla gorilla KCNS1 protein requires specific storage conditions to maintain stability and functional integrity. According to the product information, the protein should be stored at -20°C for standard storage, or at -20°C to -80°C for extended storage periods . For the lyophilized form, the shelf life is approximately 12 months when stored at these temperatures, while the liquid form maintains stability for approximately 6 months . Importantly, repeated freezing and thawing cycles should be avoided as they can lead to protein degradation and loss of activity. For routine laboratory work, it is recommended to prepare working aliquots and store them at 4°C for no longer than one week . The stability of the protein is influenced by multiple factors including buffer composition, storage temperature, and the intrinsic stability of the protein itself. Researchers should verify protein integrity before experiments, particularly for electrophysiological studies where functional activity is critical.

What experimental approaches are most effective for studying KCNS1-partner channel interactions?

Studying KCNS1's interactions with partner channels requires specialized experimental approaches that can capture both physical interactions and functional consequences. Co-immunoprecipitation using antibodies against KCNS1 or potential partner channels can identify physical associations between these proteins. For functional studies, electrophysiological techniques such as patch-clamp recording in heterologous expression systems (e.g., Xenopus oocytes or mammalian cell lines) where KCNS1 and candidate partner channels are co-expressed provide direct assessment of functional modulation. Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) can visualize protein-protein interactions in living cells. Drawing from approaches used with related potassium channels, mutagenesis of the voltage-sensing domain and chemical modification studies can reveal how KCNS1 affects channel gating . These approaches should be combined with careful controls, including expression of partner channels alone and co-expression with mutated versions of KCNS1, to establish specific modulatory effects.

How can researchers effectively use antibodies against potassium channels in their experiments?

Antibodies against potassium channels, including KCNS1, are valuable tools for various research applications. While the search results don't provide information about KCNS1-specific antibodies, principles from related channels like KCNB1 can be applied . For immunodetection applications, polyclonal antibodies raised against synthetic peptides derived from specific domains of the channel provide versatility across multiple techniques. These antibodies can be used in Western blotting (WB), immunofluorescence (IF), and enzyme-linked immunosorbent assay (ELISA) with appropriate dilutions . For Western blotting, dilutions ranging from 1:500 to 1:5000 may be appropriate, while immunofluorescence typically requires more concentrated antibody (1:100 to 1:1000) . Researchers should optimize dilutions for their specific experimental conditions and always include appropriate positive and negative controls. Cross-reactivity between species should be considered - for example, some antibodies may recognize epitopes conserved across human, mouse, and rat orthologs . For co-localization studies, combining antibodies against KCNS1 and its potential partner channels can provide valuable insights into their spatial relationships in native tissues.

What expression vectors and protocols yield optimal recombinant KCNS1 production?

Optimal production of recombinant KCNS1 requires careful consideration of expression vectors and protocols. The recombinant Gorilla gorilla gorilla KCNS1 described in the search results is produced using an in vitro E. coli expression system . For successful expression, the full coding sequence (amino acids 1-526) is typically cloned into a vector containing an N-terminal 10xHis-tag for purification purposes . When designing expression strategies, researchers should consider codon optimization for the host system, as Gorilla gorilla sequences may contain codons rarely used in E. coli. Induction conditions, including temperature, inducer concentration, and duration, significantly impact yield and solubility of membrane proteins like KCNS1. Lower induction temperatures (16-20°C) often improve proper folding of transmembrane proteins. For purification, immobilized metal affinity chromatography (IMAC) leveraging the His-tag, followed by size exclusion chromatography, can yield high-purity protein. Alternative expression systems, such as mammalian cells, might be considered when post-translational modifications are critical for the research question being addressed.

How does Gorilla gorilla gorilla KCNS1 compare structurally and functionally to human KCNS1?

A detailed comparative analysis of Gorilla gorilla gorilla KCNS1 and human KCNS1 reveals important insights about evolutionary conservation of this potassium channel modifier. The gorilla KCNS1 protein (UniProt: A4K2R3) consists of 526 amino acids and shares high sequence homology with its human ortholog . This conservation suggests critical functional constraints on KCNS1 structure throughout primate evolution. The transmembrane domains and pore regions likely show the highest conservation, as these regions are essential for membrane integration and channel modulation. The N-terminal and C-terminal cytoplasmic domains may exhibit more variation, potentially reflecting species-specific regulatory mechanisms. Functionally, both gorilla and human KCNS1 are expected to serve as silent modulators that form heteromultimers with functional potassium channels . Electrophysiological studies comparing the modulatory effects of gorilla versus human KCNS1 on identical partner channels would provide valuable insights into any species-specific functional differences. Such comparative approaches contribute to our understanding of potassium channel evolution and may identify species-specific adaptations in neuronal excitability regulation.

What can researchers learn from studying potassium channels across different primate species?

Studying potassium channels across different primate species provides valuable evolutionary and functional insights. The availability of recombinant Gorilla gorilla gorilla KCNS1, alongside data from human potassium channels, enables direct comparative analyses . Such cross-species comparisons can identify highly conserved regions that likely serve critical functions, maintained through evolutionary pressure. Conversely, regions showing higher sequence divergence may represent species-specific adaptations or regions under relaxed functional constraints. Functional studies comparing electrophysiological properties of channels from different primates can reveal subtle evolutionary adaptations in neuronal excitability that might correlate with species-specific cognitive or neurological traits. Additionally, comparative analyses across primates can strengthen translational research by identifying conserved drug binding sites likely to exhibit similar pharmacological responses across species. The genomic context of potassium channel genes in different primates, including examination of regulatory regions, can also provide insights into the evolution of expression patterns and tissue specificity across primate lineages.

How do expression patterns of KCNS1 differ across tissues in primates compared to other mammals?

While the search results don't provide specific information about KCNS1 expression patterns across tissues, general principles can guide research in this area. The expression distribution of potassium channels often correlates with their physiological roles in different tissues. KCNS1, as a modifier of neuronal excitability, likely shows prominent expression in the nervous system, particularly in neurons where precise regulation of action potential characteristics is crucial. Comparative transcriptomic analyses between gorillas, humans, and other mammals would reveal conservation or divergence in tissue-specific expression patterns. Quantitative approaches such as RT-qPCR, RNA sequencing, or tissue microarrays comparing matched tissues across species could identify primate-specific expression patterns. Immunohistochemistry using antibodies recognizing conserved epitopes of KCNS1 would provide spatial resolution of expression at the cellular and subcellular levels. Differences in expression patterns between primates and other mammals might reflect adaptations in neuronal function that correlate with cognitive capabilities, sensory processing, or other species-specific neurological traits.

What are common challenges in electrophysiological studies of KCNS1 and how can they be addressed?

Electrophysiological studies of KCNS1 present several specific challenges due to its nature as a modulatory subunit. The primary challenge stems from KCNS1's inability to form functional homomeric channels, necessitating co-expression with partner channels to observe its modulatory effects . Researchers should first establish reliable expression and recording protocols for the partner channels alone before introducing KCNS1 to clearly distinguish modulation from inherent channel properties. Variability in expression levels between KCNS1 and partner channels can complicate interpretation; using bicistronic vectors or fluorescently tagged constructs can help confirm co-expression in the same cells. For patch-clamp studies, the formation of heteromultimers may show slower kinetics than homomeric channels, requiring extended incubation after transfection. Challenges in distinguishing endogenous channel activity from recombinant channels can be addressed using heterologous systems with minimal endogenous potassium currents or employing channel blockers to isolate specific conductances. Finally, the modulatory effects of KCNS1 may be subtle, requiring sensitive equipment and careful analysis of kinetics, voltage dependence, and other biophysical parameters to detect significant changes.

How can researchers troubleshoot protein degradation issues with recombinant KCNS1?

Protein degradation represents a significant challenge when working with recombinant transmembrane proteins like KCNS1. To minimize degradation during storage, researchers should follow the recommended storage conditions: -20°C for standard storage or -20°C to -80°C for extended periods . The lyophilized form generally offers better stability (shelf life of 12 months) compared to the liquid form (6 months) . Aliquoting the protein to avoid repeated freeze-thaw cycles is crucial, as each cycle can contribute to protein degradation . For working stocks, storage at 4°C is acceptable but should be limited to one week . Buffer optimization can significantly impact stability - including appropriate protease inhibitors, optimizing pH, and adding stabilizing agents like glycerol can help maintain protein integrity. When degradation is observed despite these precautions, adjusting purification protocols may be necessary, potentially including additional chromatography steps to remove contaminating proteases. For verification of protein integrity before experiments, analytical techniques such as SDS-PAGE, Western blotting, or size exclusion chromatography can be employed to assess degradation products. If degradation persists, expressing smaller functional domains rather than the full-length protein might provide a more stable alternative for certain applications.

What strategies can overcome expression and solubility challenges with KCNS1?

Transmembrane proteins like KCNS1 often present significant challenges in expression and solubility. When working with recombinant Gorilla gorilla gorilla KCNS1, several strategies can address these challenges. For expression optimization in E. coli systems, adjusting induction conditions is crucial - lower temperatures (16-20°C), reduced inducer concentrations, and extended induction times often improve folding of membrane proteins . Specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), may yield better results than standard strains. Fusion partners that enhance solubility, such as maltose-binding protein (MBP) or small ubiquitin-like modifier (SUMO), can be considered alongside the existing His-tag . For solubilization and purification, screening different detergents is essential - mild non-ionic detergents like DDM or LMNG often provide a good balance between efficiency and preservation of protein structure. Alternative expression systems, including insect cells (baculovirus) or mammalian cells, might overcome expression challenges encountered in bacterial systems, particularly for proteins requiring post-translational modifications. For functional studies, expression in Xenopus oocytes provides a robust system for electrophysiological characterization without requiring protein purification.

How can researchers validate the functional activity of recombinant KCNS1?

Validating the functional activity of recombinant KCNS1 requires specialized approaches that account for its role as a modulatory subunit rather than a channel-forming protein in its own right . Since KCNS1 does not form functional homomeric channels but instead modulates other potassium channels through heteromultimerization, functional validation requires co-expression with known partner channels . Electrophysiological techniques such as two-electrode voltage clamp in Xenopus oocytes or patch-clamp recording in mammalian cells represent the gold standard for functional validation, allowing direct measurement of how KCNS1 alters channel properties including activation/inactivation kinetics, voltage dependence, and current amplitude. Biochemical approaches can validate KCNS1's ability to form protein-protein interactions with partner channels - co-immunoprecipitation or proximity ligation assays can confirm physical association, while blue native PAGE can detect the formation of heteromultimeric complexes. Fluorescence-based trafficking assays can assess whether KCNS1 properly localizes to the plasma membrane when expressed alone or with partner subunits. These complementary approaches provide a comprehensive validation strategy addressing both the physical interactions and functional consequences of KCNS1 expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.