Recombinant Gorilla gorilla gorilla Probable G-protein coupled receptor 34 (GPR34)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR34; Probable G-protein coupled receptor 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTS YSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKW TLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWM LALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIK IGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCY WKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFK PGYSLHDTSVAVKIQSSSKST
Uniprot No.

Target Background

Function
Orphan receptor.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR34 and what is its evolutionary significance?

GPR34 is a member of the G-protein-coupled receptor (GPCR) superfamily, structurally related to a group of ADP-like receptors. It represents an evolutionarily old GPCR that has been preserved across vertebrate species . The receptor demonstrates notable conservation in its genomic organization, particularly in its 5' noncoding intron-exon structure, despite having an intronless coding region in many species .

This evolutionary preservation suggests important biological functions that have been maintained throughout vertebrate evolution. The receptor's structure and signaling mechanisms show similarities across species, making comparative studies between organisms (including Gorilla gorilla gorilla) valuable for understanding fundamental GPCR biology.

What is the natural ligand for GPR34 and how does it function?

Lysophosphatidylserine (LysoPS) has been identified as the natural ligand for GPR34 . When LysoPS binds to GPR34, it triggers receptor activation and subsequent signaling cascades. In its wild-type form, GPR34 primarily signals through several pathways including cAMP/PKA (via CRE), NF-κB, AP1 (MAPK/JNK), and to some extent SRF-RE (RhoA) and SRE (MAPK/ERK) pathways .

The interaction between LysoPS and GPR34 can be demonstrated through in vitro assays using dual luciferase reporter systems that monitor the activation of these downstream pathways. Notably, LysoPS is generated through the action of phospholipase A on phosphatidylserine, often exposed on apoptotic cells, suggesting GPR34 may play roles in immune responses or tissue homeostasis .

What is the protein structure of GPR34 and its key functional domains?

GPR34, like other GPCRs, consists of seven transmembrane domains with extracellular and intracellular loops. The full-length mouse GPR34 contains 375 amino acids, and similar structures exist across species . Key functional regions include:

  • The N-terminus, which can vary in length due to alternative splicing and multiple translation initiation sites

  • The transmembrane domains, which are crucial for ligand binding and signal transduction

  • The C-terminus, which contains phosphorylation motifs important for receptor desensitization

  • The first intracellular loop, which contains a tribasic RKR motif that serves as a key topogenic signal determining the orientation of the first transmembrane domain

Mutations in these regions, particularly in the C-terminus, can significantly alter receptor function, as demonstrated by studies on the Q340X truncation that removes phosphorylation sites necessary for proper receptor internalization and desensitization .

What are the optimal expression systems for producing recombinant GPR34?

For recombinant GPR34 production, several expression systems have been successfully employed, each with distinct advantages:

E. coli Expression System:

  • Advantages: High yield, cost-effective, rapid production

  • Considerations: Lacks post-translational modifications; requires optimization for membrane protein expression

  • Example: Mouse GPR34 has been successfully expressed in E. coli with N-terminal His-tag fusion

Mammalian Cell Systems:

  • Advantages: Proper folding and post-translational modifications, particularly for functional studies

  • Example: Flp-InTRex293 cells have been used to generate isogenic cell lines expressing GPR34 wild-type and mutant variants for functional characterization

What methods are most effective for assessing GPR34 signaling activity?

Several complementary approaches can effectively assess GPR34 signaling:

Dual Luciferase Reporter Assays:

  • These assays have successfully measured GPR34 activation of multiple downstream pathways including CRE, NF-κB, AP1, SRF-RE, SRE, ISRE, TCF/LEF-RE, and NFAT-RE

  • This approach allows for comparative analysis of wild-type vs. mutant receptor signaling capacity

G Protein Coupling Analysis:

  • Computational prediction tools such as PRECOG can estimate G protein coupling profiles for GPR34 variants

  • Experimental validation can be performed through co-immunoprecipitation or BRET-based assays

Functional Cellular Assays:

  • Apoptosis resistance assays

  • Receptor internalization assays following LysoPS stimulation

  • Transforming potential assays

When designing experiments to assess GPR34 signaling, it is important to consider both ligand-independent (constitutive) activity and ligand-dependent responses, particularly when studying mutant variants with potentially altered signaling properties .

How should researchers prepare and handle recombinant GPR34 protein to maintain stability and function?

For optimal handling of recombinant GPR34:

Storage Conditions:

  • Lyophilized protein should be stored at -20°C to -80°C upon receipt

  • Working aliquots can be stored at 4°C for up to one week

  • Repeated freeze-thaw cycles should be avoided to prevent protein degradation

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Aliquot for storage at -20°C/-80°C

Buffer Considerations:

  • Tris/PBS-based buffers at pH 8.0 with 6% Trehalose have been successfully used for GPR34 proteins

  • For functional studies, detergent selection is critical; mild non-ionic detergents like DDM or LMNG are often suitable for maintaining GPCR stability

How do mutations in GPR34 alter its signaling properties and what are the implications for disease?

GPR34 mutations have been specifically associated with salivary gland MALT lymphoma (SG-MALT-lymphoma), with significant functional consequences . Key findings include:

Effects of C-terminal Truncations:

  • Most GPR34 mutations in SG-MALT-lymphoma cluster in the C-terminus, resulting in truncated proteins lacking phosphorylation motifs important for receptor desensitization

  • The Q340X truncation mutant demonstrates:

    • Significantly increased resistance to apoptosis

    • Greater transforming potential than wild-type GPR34

    • Delayed internalization after LysoPS stimulation

    • Significantly enhanced activation of CRE, NF-κB, and AP1 reporter activities

Missense Mutations:

  • The D151A mutation shows moderate enhancement of NF-κB and AP1 signaling pathways

  • The R84H mutation, despite affecting the tribasic RKR motif in the first intracellular loop, shows no apparent functional differences from wild-type in most assays, likely due to its conservative amino acid replacement

These findings suggest that certain GPR34 mutations, particularly C-terminal truncations, represent gain-of-function alterations that may contribute to lymphomagenesis by promoting cell survival and proliferation through enhanced downstream signaling.

What is the role of GPR34 in the pathogenesis of lymphoepithelial lesions and MALT lymphoma?

Research has revealed a potential bridge between lymphoepithelial lesions (LELs) and salivary gland MALT lymphoma through GPR34 activation. The proposed mechanism involves:

  • Phospholipase-A1 is abundantly expressed in the duct epithelium of salivary glands and in LELs

  • These phospholipases are released by LELs and hydrolyze phosphatidylserine exposed on apoptotic cells

  • This hydrolysis generates lysophosphatidylserine (LysoPS), the ligand for GPR34

  • LysoPS provides paracrine stimulation to malignant B cells via GPR34, particularly those with gain-of-function mutations

  • Enhanced GPR34 signaling promotes cell survival and proliferation through activation of multiple downstream pathways

This model explains the specific association between GPR34 genetic alterations and SG-MALT-lymphoma, suggesting that the unique microenvironment of salivary gland LELs provides both the context and the stimulus (LysoPS) for GPR34-driven lymphomagenesis.

How does alternative splicing and multiple translation initiation affect GPR34 protein diversity and function?

GPR34 demonstrates remarkable supragenomic diversification through several mechanisms:

Alternative Splicing:

  • A cryptic intron within the coding region has been identified that, when utilized, shortens the N-terminus by 47 amino acids

  • This alternative splicing is evolutionarily preserved across vertebrate species, suggesting functional significance

Multiple Translation Initiation:

  • Several conserved in-frame AUGs within the first 150 bp of the coding region serve as alternative translation start sites

  • In humans and other mammals, there appears to be a preference for the second in-frame AUG, although other start sites are also utilized

  • This has been confirmed through combinatory mutagenesis and expression of reporter constructs

Tissue-Specific Transcriptional Regulation:

  • In rodents, GPR34 expression is driven by at least two distinct promoter regions

  • The activity of these promoters varies in a tissue-specific manner, despite both being active in all tissues examined

  • In humans, only one major transcriptional start region has been identified

This multi-level diversity may allow for fine-tuning of GPR34 expression and function across different tissues and developmental stages, potentially adapting its signaling properties to specific cellular contexts.

What insights can be gained from studying recombinant GPR34 from different species?

Cross-species analysis of GPR34 offers valuable insights:

  • Evolutionary Conservation and Divergence:

    • Comparison of GPR34 sequence, structure, and function across species helps identify critical conserved domains versus species-specific adaptations

    • These comparisons can highlight the receptor's core functions versus specialized roles that emerged in specific lineages

  • Structure-Function Relationships:

    • Natural variations in GPR34 across species can serve as "natural mutants" to understand structure-function relationships

    • Differences in ligand binding affinity or signaling efficiency between species variants can reveal key functional residues

  • Disease Mechanisms:

    • Species differences in susceptibility to GPR34-associated pathologies can illuminate protective mechanisms

    • The study of gorilla GPR34 may provide insights into primate-specific aspects of receptor function relevant to human disease

  • Therapeutic Development:

    • Cross-species conservation data helps identify targetable regions for therapeutic development

    • Understanding species-specific differences is critical for preclinical testing of GPR34-targeted therapies

What are common challenges in expressing and purifying functional recombinant GPR34?

Researchers working with recombinant GPR34 encounter several technical challenges:

Expression Challenges:

  • As a seven-transmembrane protein, GPR34 can be difficult to express in soluble, correctly folded form

  • Expression in E. coli often results in inclusion bodies requiring refolding protocols

  • Mammalian expression systems may yield correctly folded protein but at lower quantities

Purification Considerations:

  • Detergent selection is critical for maintaining protein stability during extraction from membranes

  • His-tagged constructs allow for affinity purification, but optimization of imidazole concentration is necessary to minimize non-specific binding while maximizing target protein yield

  • Proper buffer conditions (pH 8.0 with stabilizing agents like trehalose) help maintain protein integrity during purification and storage

Functional Verification:

  • Confirming that recombinant GPR34 retains native ligand binding and signaling capabilities requires specialized assays

  • Stable cell lines expressing single copies of GPR34 (such as Flp-InTRex293 systems) provide more consistent results for functional studies than transient overexpression

How can researchers troubleshoot GPR34 functional assays when results are inconsistent?

When facing inconsistent results in GPR34 functional assays, consider these troubleshooting approaches:

Ligand Quality and Concentration:

  • LysoPS quality can vary between commercial sources

  • Concentration-response curves should be performed to determine optimal ligand concentrations

  • Different LysoPS species (varying fatty acid chains) may have different potencies

Receptor Expression Levels:

  • Verify consistent receptor expression through Western blot or flow cytometry

  • Consider using inducible expression systems to control expression levels

  • Single-copy integration systems (like Flp-In) provide more consistent expression than random integration

Signaling Readout Selection:

  • GPR34 activates multiple pathways with varying efficiencies

  • If one pathway shows inconsistent results, test alternative signaling readouts (CRE, NF-κB, AP1)

  • Include positive controls for each signaling pathway

Cell Line Considerations:

  • Background signaling in host cells can affect results

  • Parental cell lines should be tested alongside GPR34-expressing lines

  • Consider the endogenous G protein repertoire of the chosen cell line

What advanced analytical techniques can be applied to study GPR34 structure-function relationships?

Several cutting-edge techniques can provide deeper insights into GPR34 biology:

Structural Biology Approaches:

  • Cryo-electron microscopy (cryo-EM) has revolutionized GPCR structural biology and could be applied to GPR34

  • X-ray crystallography requires significant protein engineering but can provide high-resolution structures

  • NMR spectroscopy can provide dynamic information about receptor conformational changes

Advanced Functional Assays:

  • BRET/FRET-based assays can monitor real-time conformational changes and protein-protein interactions

  • Label-free technologies (e.g., dynamic mass redistribution) can detect native receptor signaling without reporter modifications

  • Single-molecule approaches can reveal heterogeneity in receptor behavior not apparent in population-based assays

Computational Methods:

  • Molecular dynamics simulations can model GPR34 interactions with ligands and G proteins

  • Machine learning approaches (like PRECOG) can predict G protein coupling profiles

  • Evolutionary analysis can identify conserved functional motifs and species-specific variations

These advanced techniques, when combined with traditional approaches, provide comprehensive insights into GPR34 biology from molecular structure to cellular function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.