Recombinant Gorilla gorilla gorilla Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Gorilla gorilla gorilla Suppressor of Tumorigenicity 7 Protein (ST7)

Recombinant Gorilla gorilla gorilla Suppressor of Tumorigenicity 7 protein (ST7) is a manufactured version of the ST7 protein found in the Western lowland gorilla (Gorilla gorilla gorilla) . ST7, also known as LRP12, RAY1, TSG7, and FAM4A1, is a type I transmembrane protein that belongs to the LDLR superfamily . It is similar in structure to ST7 proteins found in other species, sharing 98% amino acid sequence identity within the extracellular domain with bovine, equine, and porcine ST7 .

Key Features:

  • Source: Produced in E. coli .

  • Tag: Contains an N-terminal His tag .

  • Protein Length: Full Length (1-585 amino acids) .

  • Purity: Greater than 90% as determined by SDS-PAGE .

  • Synonyms: ST7; Suppressor of tumorigenicity 7 protein .

  • UniProt ID: Q2IBE8 .

Protein Structure and Characteristics

The ST7 protein has multiple structural features :

  • A 32 amino acid signal sequence.

  • A 460 amino acid extracellular domain (ECD) containing two CUB domains and five LDLR class A domains.

  • A 21 amino acid transmembrane domain.

  • A 346 amino acid cytoplasmic domain containing motifs implicated in endocytosis and signal transduction.

Gene Information

The gene encoding ST7 is referred to as ST7 . Genomic sequencing suggests the potential for up to 18 splicing isoforms, though their expression has not been thoroughly investigated .

Expression and Tissue Distribution

ST7 is broadly expressed in normal tissues, particularly in fibroblasts . The highest mRNA levels have been found in the heart and skeletal muscle .

Recombinant Protein Properties

Recombinant ST7 protein is available as a lyophilized powder . It is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the possible addition of 5-50% glycerol for long-term storage at -20°C/-80°C . Repeated freezing and thawing should be avoided .

Applications

Recombinant human ST7 protein can be used in various bioactivity assays . When immobilized at 0.5 µg/mL, the concentration of recombinant human LRPAP (Catalog # 4296-LR) that produces 50% of the optimal binding response is approximately 0.6‑3 μg/mL .

Data Table

FeatureDescription
SpeciesGorilla gorilla gorilla (Western lowland gorilla)
SourceE. coli
TagHis
Protein LengthFull Length (1-585)
PurityGreater than 90% as determined by SDS-PAGE
FormulationLyophilized from a 0.2 μm filtered solution in PBS
ReconstitutionReconstitute at 200 μg/mL in PBS
Stability and StorageUse a manual defrost freezer and avoid repeated freeze-thaw cycles
AA SequenceMAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPVSQHFQN

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its use.
Synonyms
ST7; Suppressor of tumorigenicity 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
ST7
Target Protein Sequence
MAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN
Uniprot No.

Target Background

Database Links
Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant Gorilla gorilla gorilla ST7 protein?

Recombinant Gorilla gorilla gorilla ST7 protein is typically supplied as a lyophilized powder and requires specific handling protocols to maintain stability and activity :

Storage ParameterRecommended Condition
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Recommended additives5-50% glycerol (final concentration)
Freeze-thaw cyclesMinimize; repeated cycles not recommended

Methodological considerations:

  • Prior to opening, briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute in deionized sterile water to the recommended concentration

  • For long-term storage, aliquot the reconstituted protein with glycerol and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they can lead to protein degradation

  • When preparing working solutions, maintain sterile conditions to prevent microbial contamination

How can researchers effectively express and purify recombinant Gorilla gorilla gorilla ST7 protein for functional studies?

Expression and purification of recombinant Gorilla gorilla gorilla ST7 protein involves several critical methodological steps:

  • Expression System Selection: E. coli is the most commonly used expression system for Gorilla ST7 protein . BL21(DE3) or Rosetta strains are recommended for optimal expression.

  • Vector Design:

    • Insert the full-length Gorilla ST7 coding sequence (1-585 amino acids) into an expression vector

    • Include an N-terminal His-tag for purification purposes

    • Optimize codon usage for E. coli to enhance expression efficiency

  • Purification Strategy:

    • Lyse cells in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, and protease inhibitors

    • Purify using Ni-NTA affinity chromatography

    • Elute with imidazole gradient (50-250 mM)

    • Further purify by size exclusion chromatography

    • Assess purity by SDS-PAGE (should be >90%)

  • Quality Control:

    • Verify protein identity by Western blot or mass spectrometry

    • Assess protein folding by circular dichroism

    • Test biological activity through functional assays

What are the molecular mechanisms through which ST7 exerts its tumor suppressor activity, and how can recombinant Gorilla ST7 protein be used to investigate these pathways?

The molecular mechanisms of ST7-mediated tumor suppression are complex and still being elucidated. Research suggests several key pathways:

  • Regulation of Angiogenesis:

    • ST7 may inhibit tumor angiogenesis, as preliminary evidence suggests involvement in regulating blood vessel growth

    • Functional studies indicate that tumors lacking ST7 show enhanced vascularization

  • Cell Cycle Regulation:

    • ST7 appears to negatively regulate cell cycle progression

    • Gene Ontology (GO) analysis reveals enrichment in "negative regulation of the cell cycle" category

  • Interaction with Other Tumor Suppressors:

    • Similar to the Pbx1-Prep1 interaction described for other tumor suppressors, ST7 may function through protein-protein interactions

    • Competitive binding mechanisms with oncogenic proteins may be involved

  • Epigenetic Regulation:

    • Several studies suggest that ST7 function may be abrogated through epigenetic mechanisms rather than direct mutations

    • DNA methylation and histone modifications of the ST7 promoter region may contribute to silencing

Experimental approaches using recombinant Gorilla ST7 protein:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.