Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 16 (TAS2R16)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

TAS2R16 is specialized for detecting β-glucosides, such as salicin (salicylic acid β-D-glucoside) and arbutin, which are prevalent in plants. In primates, this receptor is linked to bitter perception and may influence dietary preferences .

Ligand Specificity

Studies on primate TAS2R16 orthologs highlight variable sensitivity to β-glucosides:

SpeciesLigandSensitivity (EC₅₀)Key Residues
HumanSalicinHigh (low EC₅₀)W261, F198
MacaqueSalicin10-fold lower than humanN172, F198
Gorilla (Inferred)β-GlucosidesConserved sensitivityTM3, TM7 residues

Note: Gorilla TAS2R16 sensitivity is inferred from structural homology with human and macaque orthologs .

Evolutionary Conservation

Phylogenetic analysis indicates that β-glucoside sensitivity in TAS2R16 is conserved across primates, including gorillas, suggesting ancestral adaptation to plant toxins .

Biological Relevance

  • Dietary Adaptation: TAS2R16 may influence gorilla avoidance of bitter plant toxins, shaping foraging behavior .

  • Cross-Species Comparisons: Structural differences between gorilla, human, and macaque TAS2R16 (e.g., residues N172K, F198L) correlate with species-specific ligand sensitivities .

Research Tools

Recombinant gorilla TAS2R16 is used in:

  1. In Vitro Assays: Calcium flux or luciferase reporter systems to screen bitter compounds .

  2. Structural Modeling: Predicting ligand-binding modes using homology to human TAS2R16 .

Interaction Partners

TAS2R16 interacts with proteins involved in bitter signaling:

PartnerRoleEvidence
Gustducin (GNAT3)G-protein activationCoexpression studies
TRPM5Ion channel regulationShared signaling pathway
TAS1R1/TAS1R3Heterodimerization in taste budsPredicted interaction

Challenges and Future Directions

  • Structural Elucidation: No crystal structures exist for gorilla TAS2R16; homology modeling remains reliant on human data .

  • Functional Validation: Direct studies on gorilla TAS2R16 ligand specificity are needed to confirm inferred properties .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
TAS2R16; Taste receptor type 2 member 16; T2R16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQ WASMLNBFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRW RILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLEKFHQYEFQA HTVALVIPFILFLASTILLMASLTKQIQHHSTGHCNPSMKAHFTALRSLAVLFIVFTSYF LTILITIIGTLFDRRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is linked to gustducin. It may also be involved in sensing the chemical composition of the gastrointestinal content. The activation of this receptor can stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TAS2R16 and what is its primary function in primates?

TAS2R16 is a G protein-coupled receptor (GPCR) that functions as a bitter taste receptor, primarily responding to β-D-glucopyranosides including salicin . This receptor is part of the T2R family of taste receptors that mediate bitter taste perception and is expressed in taste receptor cells on the tongue . In primates, including both humans and gorillas, TAS2R16 plays a crucial role in detecting potentially harmful bitter compounds in food, which may have evolved as a protective mechanism against the ingestion of toxic plant compounds .

The receptor's function extends beyond simple taste perception, as recent research has identified TAS2R16 expression in non-gustatory tissues, suggesting roles in physiological processes unrelated to taste . These include potential involvement in inflammatory responses, with studies showing that TAS2R activation can inhibit inflammatory processes such as the suppression of proinflammatory cytokine release . The evolutionary conservation of TAS2R16 across primate species underscores its biological significance beyond being merely a taste detection system.

Studies of TAS2R16 in both humans and gorillas provide valuable comparative data about taste perception mechanisms and their evolution in primates, with implications for understanding dietary adaptations and evolutionary responses to environmental bitter compounds.

How is recombinant TAS2R16 protein typically produced for research purposes?

Recombinant TAS2R16 protein from Gorilla gorilla gorilla is typically produced using prokaryotic expression systems, primarily Escherichia coli (E. coli) as indicated in product information for commercially available proteins . The recombinant protein production process begins with the isolation and cloning of the TAS2R16 gene sequence from gorilla genomic material, followed by insertion into appropriate expression vectors that enable protein production in bacterial hosts .

For functional studies, researchers often create expression constructs that include epitope tags (such as FLAG tags) to facilitate detection and purification of the expressed protein . When studying receptor function in vitro, the TAS2R16 coding sequence is typically transfected into mammalian cell lines such as HEK293T cells, often co-expressed with G-protein components like Gα16gust44 (a chimera containing the last 44 amino acids of rat gustducin) to enable signaling cascade activation and measurement .

For structural and biochemical analyses requiring purified protein, the recombinant TAS2R16 is typically supplied in liquid form containing glycerol for stabilization and can be stored at -20°C or -80°C for extended periods . Repeated freezing and thawing is not recommended, and working aliquots are typically maintained at 4°C for up to one week to preserve protein integrity and function .

What are the commonly studied polymorphisms in TAS2R16 and their functional significance?

Several key polymorphisms in TAS2R16 have been extensively studied for their functional impacts on receptor activity and bitter taste perception. The most significant polymorphism occurs at nucleotide position 516, resulting in an amino acid change at position 172 from lysine (K) to asparagine (N) . This substitution substantially affects receptor function, with the derived N-variant (T-allele) demonstrating approximately 1.5- to 2-fold higher surface expression compared to the ancestral K-variant (G-allele), providing a molecular basis for increased sensitivity to bitter compounds like salicin .

Other notable polymorphisms include:

  • Position 340 (amino acid 114): A change from isoleucine (I) to valine (V) that results in reduced surface expression and function of the receptor .

  • Position 481 (amino acid 161): A proline (P) to serine (S) substitution that shows no significant effect on receptor function .

  • Position 605 (amino acid 202): A serine (S) to leucine (L) substitution with no observed effect on function .

  • Positions 662/663 (amino acid 221): An alanine (A) to valine (V) change with minimal effects on function .

  • Position 665 (amino acid 222): A histidine (H) to arginine (R) substitution with little functional impact .

Recent studies have also identified additional SNPs including rs978739, rs1357949, and rs860170 that may have biological significance, particularly in contexts beyond taste perception such as in pituitary adenoma development .

The following table summarizes the key nonsynonymous polymorphisms observed in TAS2R16 and their functional effects:

Nucleotide PositionAmino Acid PositionAncestral AADerived AAFunctional Effect
340114IVReduced surface expression and function
481161PSNo effect
516172KNReduced surface expression of ancestral allele
605202SLNo effect
662/3221AVNo or weak effect on function
665222HRNo or weak effect on function
282269IVNo effect

What methods are used to measure TAS2R16 receptor activity in experimental settings?

Researchers employ several complementary methods to assess TAS2R16 receptor activity in experimental settings. The most common approach involves heterologous expression systems, particularly HEK293T cells transfected with TAS2R16 receptor constructs along with G-protein components that couple to the receptor's signaling pathway . These systems allow for controlled investigation of receptor function in response to various agonists.

Cell surface expression assays are crucial for quantifying the trafficking of TAS2R16 receptors to the plasma membrane, which directly impacts functional capacity . A typical protocol involves:

  • Transfection of cells with TAS2R16 constructs containing extracellular epitope tags (such as FLAG)

  • Fixation of cells with paraformaldehyde

  • Immunostaining with anti-epitope antibodies (e.g., anti-FLAG MAb M2)

  • Quantification of surface expression using flow cytometry

Functional calcium flux assays are employed to measure receptor activation upon ligand binding. When activated, TAS2R16 triggers a signaling cascade that results in intracellular calcium release, which can be measured using calcium-sensitive fluorescent dyes . The amplitude and kinetics of the calcium response correlate with receptor activation efficacy and potency.

In vivo taste sensitivity testing in human subjects provides a complementary approach to in vitro studies. Participants are typically presented with solutions containing bitter compounds at varying concentrations to determine detection thresholds, which can then be correlated with their TAS2R16 genotype . This approach has been valuable in establishing genotype-phenotype relationships for TAS2R16 variants across diverse populations.

How do evolutionary analyses inform our understanding of TAS2R16 function across primate species?

Evolutionary analyses of TAS2R16 reveal a complex selection history that provides insight into the functional importance of this receptor across primate lineages. The gene exhibits remarkably deep coalescence times, with estimates suggesting an origin of variation at approximately 1.75 million years ago (±745,743 years) . The derived "high-sensitivity" N-variant at position 172 (T-allele at nucleotide 516) is particularly ancient, estimated to have emerged around 1.1 million years ago (±440,115 years) . This considerable age suggests the functional importance of this variation has been maintained through evolutionary time.

Population genetic analyses reveal signatures of differential selection acting on TAS2R16 alleles. The derived "high-sensitivity" T-allele exhibits a "star-like" genealogy characteristic of positive selection, while haplotypes carrying the ancestral "low-sensitivity" G-allele show evidence of strong purifying selection . These contrasting selection patterns indicate that both maintaining bitter sensitivity and preserving ancestral function have been important throughout human evolution.

Analyses of population differentiation show that the FST value among African populations (FST = 0.076) for the functional SNP at position 516 is an outlier in genome-wide distributions, falling in the top one percentile . This elevated genetic differentiation is significantly different from genome-wide patterns (P = 0.000001), consistent with a model of local adaptation at this locus in Africa . Such population structure suggests that regional ecological factors, likely related to diet and available plant compounds, have shaped TAS2R16 variation.

Comparative studies of TAS2R16 across species reveal remarkable conservation of agonist responses, with many compounds that activate human TAS2R16 also activating orthologs in other species despite dietary differences . This conservation suggests fundamental constraints on the evolution of bitter taste receptor function that transcend species-specific dietary adaptations.

What are the methodological challenges in expressing and characterizing gorilla TAS2R16 compared to human variants?

Expression and characterization of gorilla TAS2R16 present several unique methodological challenges compared to human variants. One primary difficulty involves obtaining and validating the authentic gorilla TAS2R16 sequence, as reference genomes for non-human primates may contain errors or gaps that complicate cloning efforts . Researchers must carefully verify sequences through multiple methods to ensure the recombinant protein accurately represents the native gorilla receptor.

Optimization of expression systems presents another significant challenge. While E. coli is commonly used for producing recombinant proteins, membrane proteins like TAS2R16 often express poorly in prokaryotic systems due to differences in membrane composition and protein folding machinery . Alternative expression systems, including mammalian cell lines, may be necessary for functional studies, but these introduce additional complexity in maintaining gorilla-specific post-translational modifications and protein trafficking.

When conducting comparative functional studies between human and gorilla TAS2R16, researchers must carefully control for differences in experimental parameters that might influence receptor activity independently of actual functional differences. These include:

  • Ensuring equivalent transfection efficiencies and expression levels

  • Accounting for potential differences in codon usage that might affect translation efficiency

  • Controlling for variable interactions with mammalian cellular machinery when expressing gorilla proteins in human cell lines

Assessment of ligand specificity represents another methodological challenge. The natural ligand profile for gorilla TAS2R16 may differ from human variants due to dietary specialization, requiring screening against a broader range of potential bitter compounds than typically tested with human receptors . Additionally, determining physiologically relevant concentration ranges for testing requires knowledge of gorilla dietary habits and typical compound concentrations encountered in their natural diet.

How do single nucleotide polymorphisms in TAS2R16 influence receptor trafficking and signaling pathways?

Single nucleotide polymorphisms (SNPs) in TAS2R16 can profoundly influence receptor trafficking to the cell surface and subsequent signaling pathways through several molecular mechanisms. The most well-characterized polymorphism at position 516 (K172N) significantly impacts receptor surface expression, with the derived N-variant demonstrating 1.5- to 2-fold higher trafficking to the plasma membrane compared to the ancestral K-variant . This enhanced surface expression directly correlates with increased sensitivity to bitter compounds like salicin in functional assays.

The molecular basis for differential trafficking appears to involve protein folding efficiency and quality control mechanisms in the endoplasmic reticulum. The K172N substitution likely improves protein stability or reduces retention by ER quality control systems, allowing more efficient export through the secretory pathway . Interestingly, not all nonsynonymous substitutions affect trafficking equally; the polymorphism at position 340 (I114V) reduces surface expression by approximately 2-fold, while several other amino acid substitutions show minimal effects on trafficking .

Beyond trafficking, SNPs can alter signal transduction efficiency even when receptor surface levels remain unchanged. Alterations in the transmembrane domains or intracellular loops of TAS2R16 can affect coupling to G-proteins, influencing downstream signaling cascade activation upon ligand binding . The specific G-protein coupling profile may also be modified by certain polymorphisms, potentially recruiting different signaling pathways in response to the same ligand.

Recent studies suggest that TAS2R16 variants may differentially activate pathways beyond canonical taste signaling, including those involved in inflammatory responses and cell proliferation . For instance, certain TAS2R16 mutations can result in pro-activation that triggers intracellular signaling pathways such as the NF-κB pathway, which regulates inflammatory responses and tissue homeostasis . These differential signaling properties may explain the emerging associations between TAS2R16 variants and conditions such as pituitary adenoma.

What evidence exists for non-gustatory functions of TAS2R16 in physiological and pathological contexts?

Emerging evidence suggests TAS2R16 plays significant roles beyond taste perception in both physiological and pathological contexts. Recent studies have identified TAS2R16 expression in numerous extra-oral tissues, indicating functions unrelated to gustatory sensation . One of the most compelling areas of research involves the role of TAS2R16 in inflammatory processes. Activation of taste receptors including TAS2R16 has been demonstrated to inhibit inflammatory responses, specifically by suppressing proinflammatory cytokine release . This anti-inflammatory property suggests potential therapeutic applications in inflammatory conditions.

In oncology research, TAS2R16 has demonstrated unexpected roles in cell proliferation and tumor biology. Studies have identified associations between TAS2R16 variants and pituitary adenoma (PA), a common benign tumor of the pituitary gland . Patients with PA show significantly higher serum levels of TAS2R16 compared to healthy controls (p < 0.001), suggesting altered expression patterns in the disease state . Specific genetic variants, including rs978739 and rs1357949, correlate with both serum TAS2R16 levels and protein concentrations in PA patients .

The molecular mechanisms underlying these non-gustatory functions appear to involve TAS2R16-mediated signaling pathways that influence fundamental cellular processes. Activation of TAS2R16 can trigger intracellular signaling cascades, including the NF-κB pathway, which plays crucial roles in regulating inflammatory responses and tissue homeostasis . Additionally, some studies have demonstrated that activation of certain taste receptors, including TAS2R16, can induce apoptosis in cancer cells, suggesting a potential tumor-suppressive function .

These findings collectively indicate that TAS2R16 functions as more than just a taste receptor and may represent a novel therapeutic target in conditions involving dysregulated inflammation or cell proliferation. The dual role of TAS2R16 in both sensory perception and broader physiological processes highlights the evolutionary repurposing of these receptors for diverse functions.

How can researchers effectively design mutagenesis studies to investigate structure-function relationships in TAS2R16?

Designing effective mutagenesis studies for TAS2R16 requires strategic approaches to probe structure-function relationships while minimizing experimental artifacts. Based on published methodologies, researchers should first conduct comprehensive sequence alignment analyses across species to identify conserved regions likely crucial for function and variable regions that may confer species-specific properties . This evolutionary perspective helps prioritize sites for mutagenesis that have potential functional significance.

For systematic structure-function analysis, researchers can employ several complementary mutagenesis strategies:

  • Site-directed mutagenesis targeting specific amino acids identified from natural polymorphisms, with priority given to residues showing population differentiation or signatures of selection . The critical polymorphism at position 172 (K/N) serves as a positive control for functional effects.

  • Alanine-scanning mutagenesis of predicted transmembrane domains and ligand-binding regions, systematically replacing residues with alanine to identify those critical for function without introducing potentially disruptive side chains .

  • Conservative versus non-conservative substitutions at key positions to determine the physicochemical properties (size, charge, hydrophobicity) essential for function at each site. For instance, when studying naturally occurring derived mutations, researchers can use structurally similar amino acids to test functional effects, as demonstrated in previous studies .

Experimental validation should include multiple complementary assays:

  • Cell surface expression assays using immunostaining against extracellular epitope tags (such as FLAG) with flow cytometry quantification, as described in previous studies . This identifies mutations affecting trafficking independently of ligand binding.

  • Calcium mobilization assays to measure functional responses to ligands, ideally testing multiple concentrations to generate dose-response curves that can distinguish changes in efficacy from changes in potency .

  • Binding assays with radiolabeled or fluorescent ligands to directly measure affinity changes resulting from mutations, separating binding effects from signaling effects.

The following table outlines a framework for mutagenesis experiment design based on previous successful approaches:

Mutagenesis ApproachTarget ResiduesControlsReadout AssaysData Analysis
Natural variant recreationPositions 114, 161, 172, 202, 221, 222, 269Wild-type, K172NSurface expression, calcium flux% of wild-type function
Domain swappingTransmembrane domains, loopsChimeric receptorsSurface expression, ligand responseDomain-specific functions
Conservative substitutionsCharged, polar, hydrophobic clustersSimilar size/property substitutionsSurface expression, dose-responseStructure-function maps

How can TAS2R16 research inform our understanding of evolutionary adaptations to diet in primates?

TAS2R16 research provides a unique window into primate dietary adaptations through evolutionary time. The estimated ancient age of TAS2R16 variation (approximately 1.75 million years) and the derived "high-sensitivity" allele (approximately 1.1 million years) indicates that selection pressures related to bitter taste perception have been operating over an extended evolutionary period . By studying patterns of genetic variation in TAS2R16 across primate species, researchers can reconstruct the evolutionary history of dietary adaptations and their relationship to environmental changes.

Geographic structuring of bitter taste sensitivity in Africa suggests regional adaptation to local food sources and potentially toxic compounds . The high degree of population differentiation at functional TAS2R16 variants (FST = 0.076) falling in the top one percentile of genome-wide distributions indicates that natural selection has shaped genetic variation in response to specific environmental challenges . Comparative analysis of selection signatures across primate species occupying different ecological niches can reveal parallel or divergent evolutionary trajectories in response to dietary specialization.

Researchers have inferred an East African origin for the salicin "taster" trait in humans, which correlates with historical dietary patterns and available plant compounds in this region . This geographic component to taste evolution demonstrates how local adaptation can occur even within a single species. Extending such analyses to include gorilla and other primate TAS2R16 variants would illuminate how different species have adapted their bitter taste perception to specific dietary niches.

The observation that many compounds activate TAS2R16 across multiple species despite dietary differences suggests fundamental constraints on bitter taste receptor evolution . This conservation indicates that certain aspects of bitter perception may serve critical functions beyond specific food selection, possibly including pathogen recognition or other physiological roles. Future research comparing the ligand specificity profiles of recombinant TAS2R16 from various primate species could identify species-specific adaptations while revealing conserved core functions.

What potential therapeutic applications might emerge from understanding TAS2R16 signaling pathways?

Understanding TAS2R16 signaling pathways has revealed several promising therapeutic applications beyond traditional taste-related contexts. The anti-inflammatory properties of TAS2R16 activation represent one of the most significant therapeutic potentials . Studies have demonstrated that TAS2R activation can inhibit inflammatory responses by suppressing proinflammatory cytokine release, suggesting applications in treating inflammatory conditions . Compounds that selectively activate TAS2R16 could potentially serve as novel anti-inflammatory agents with unique mechanisms of action compared to current therapies.

In oncology, the emerging connection between TAS2R16 and cell proliferation pathways presents intriguing therapeutic possibilities. Research has shown that activation of certain taste receptors, including TAS2R16, can induce apoptosis in cancer cells . The observed association between TAS2R16 variants and pituitary adenoma suggests that targeting this receptor could influence tumor development or progression . Development of specific TAS2R16 agonists or antagonists might offer new approaches for cancer treatments, particularly for tumors expressing this receptor.

The role of TAS2R16 in regulating the NF-κB pathway, which is crucial for inflammatory responses and tissue homeostasis, highlights its potential as a therapeutic target for conditions involving dysregulated NF-κB signaling . Selective modulation of this pathway through TAS2R16 could provide targeted approaches for treating conditions ranging from autoimmune disorders to certain cancers.

For practical therapeutic development, researchers must overcome several challenges:

  • Developing compounds with appropriate selectivity for TAS2R16 over other taste receptors

  • Ensuring adequate bioavailability to reach target tissues beyond the oral cavity

  • Understanding the full spectrum of physiological responses to TAS2R16 activation in diverse tissues

  • Determining optimal dosing regimens that provide therapeutic benefits while minimizing potential side effects

How can comparative studies between human and gorilla TAS2R16 advance our understanding of receptor evolution and function?

Comparative studies between human and gorilla TAS2R16 provide unique opportunities to elucidate receptor evolution and functional adaptation in closely related primate species. Despite sharing approximately 98% genetic similarity, humans and gorillas have distinct dietary patterns, with gorillas consuming significantly more plant material potentially containing bitter compounds . This dietary divergence creates a natural experiment for investigating how taste receptors adapt to ecological niches while maintaining core functionality.

Sequence comparison between human and gorilla TAS2R16 can identify sites under differential selection pressure, potentially revealing amino acid positions critical for species-specific ligand recognition . By mapping these differences onto predicted receptor structures, researchers can develop hypotheses about structure-function relationships that can be tested through targeted mutagenesis studies. The identification of highly conserved regions across these species would highlight domains essential for core receptor functions such as G-protein coupling or membrane integration.

Functional characterization of recombinant gorilla TAS2R16 compared to human variants can reveal differences in:

The existence of naturally occurring polymorphisms in both human and gorilla TAS2R16 provides an additional dimension for comparative studies . Analyzing how similar mutations affect function across species can reveal contextual factors influencing receptor properties. For instance, a mutation that substantially impacts human TAS2R16 function might have minimal effects in the gorilla ortholog due to compensatory mutations elsewhere in the sequence, illustrating the concept of epistatic interactions in receptor evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.