Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 20 (TAS2R20)

Shipped with Ice Packs
In Stock

Description

Production and Applications

Recombinant TAS2R20 is synthesized using heterologous expression systems for experimental studies:

Table 2: Production Methods for Recombinant TAS2R20

Expression SystemSource OrganismApplicationsSource
E. coliBacterialHigh-yield protein production for ELISA
YeastSaccharomyces cerevisiaeStructural studies, ligand-binding assays
BaculovirusInsect cellsFunctional assays, receptor-ligand kinetics
Mammalian CellsHuman or primateNative folding for signal transduction

Key Applications:

  • ELISA Kits: Used to quantify TAS2R20 protein levels in biological samples .

  • Functional Assays: Studies binding specificity for bitter compounds like salicin or quinine .

  • Evolutionary Studies: Tracks genetic divergence in gorilla populations .

Genetic Diversity and Evolution

TAS2R20 exhibits notable genetic variation, particularly in gorillas:

Table 3: Genetic Metrics for TAS2R20 in Global Populations

MetricValueGlobal Rank (Among TAS2Rs)Source
Nucleotide Diversity (π)0.358%Highest (98.6th percentile)
Tajima’s D−0.25Near neutrality (98th percentile)
FST (Population Differentiation)0.26Highest (98.1th percentile)

Key Findings:

  • High Polymorphism: TAS2R20 has 36 segregating sites, including 27 nonsynonymous variants .

  • Selective Pressures: Three nonsynonymous SNPs in gorillas show high derived allele frequencies (DAFs), suggesting adaptive evolution .

  • Genomic Context: TAS2R clusters in gorillas are influenced by inversions and transpositions, enabling rapid gene duplication .

Research Implications

TAS2R20’s study informs broader biological and biomedical questions:

  • Bitter Perception: Identifies ligand-binding residues (e.g., TM3, TM7 hydrophobic clusters) critical for specificity .

  • Ecological Roles: Links TAS2R20 to toxin detection and dietary adaptation in gorillas .

  • Cross-Species Comparisons: Highlights differences in ligand specificity between primates and rodents (e.g., salicin response) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
TAS2R20; TAS2R49; Taste receptor type 2 member 20; Taste receptor type 2 member 49; T2R49
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQKISSADQIIAALAVSRVGLLW VILLHWYSTVLNPTSSNLKVTIFISNAWAVTNHFSIWLAASLSIFYLLKIVNFSRLIFHH LKRKAKSVVLVIVLGSLFFLVCHLVMKSTYINVWTEEYEGNVTWKIKLRNAMHLSNLTVA MLANLIPFTLTLISFLLLIYSLCKHLKKMQLHGKGSQDPSTKIHIKALQTVTSFLILLAI YFLCLITSFWNSKMRPKEIVLMLCQAFGIIYPSFHSFILIWGNKTLKQTFLSVLWRVTCW AKGQNQSTP
Uniprot No.

Target Background

Function
This receptor is believed to play a role in the perception of bitterness and is linked to gustducin. It may contribute to sensing the chemical composition of the gastrointestinal content. The receptor's activity could potentially stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R20 and what is its primary function in gorillas?

TAS2R20 (also known as Taste receptor type 2 member 20) is a bitter taste receptor belonging to the T2R family of G protein-coupled receptors. In Western gorillas (Gorilla gorilla gorilla), this receptor functions as part of the gustatory system, enabling the detection of bitter compounds in potential food sources. The receptor is encoded by the TAS2R20 gene, which also has the synonym TAS2R49 . As with other bitter taste receptors, TAS2R20 likely plays a critical ecological role in helping gorillas avoid potentially toxic compounds in their diet by triggering aversive responses to bitter substances.

How is recombinant gorilla TAS2R20 typically produced for research purposes?

Recombinant gorilla TAS2R20 is typically produced in bacterial expression systems, with E. coli being the most common host organism . The process involves:

  • Cloning the gorilla TAS2R20 gene into an appropriate expression vector

  • Transforming the construct into competent E. coli cells

  • Inducing protein expression under controlled conditions

  • Purifying the recombinant protein using affinity chromatography

  • Storing the purified protein in a stabilizing buffer containing glycerol

The resulting recombinant protein is maintained in liquid form and should be stored at -20°C for routine use or at -80°C for extended storage. Working aliquots may be kept at 4°C for up to one week .

What is the relationship between TAS2R20 and TAS2R49 in gorillas?

Based on the available information, TAS2R20 and TAS2R49 appear to be synonyms referring to the same receptor in gorillas. Product documentation lists TAS2R49 as a gene name synonym for TAS2R20, and T2R49 is listed among the other names for this receptor . This naming variation reflects the ongoing refinement of taste receptor nomenclature as genomic and functional data accumulate. Researchers should be aware of both designations when conducting literature searches or designing experiments to ensure comprehensive coverage of all relevant information about this receptor.

Why does gorilla TAS2R20 show unusually high nucleotide diversity compared to other TAS2R genes?

Gorilla TAS2R20 exhibits exceptionally high nucleotide diversity (π = 0.358%), which places it at the 98.6th percentile of the genome-wide empirical distribution . This elevated diversity suggests several potential evolutionary scenarios:

  • Balancing selection: The high diversity might reflect maintenance of multiple alleles due to heterozygote advantage or frequency-dependent selection

  • Relaxed selective constraints: TAS2R20 may be under less functional constraint than other TAS2R genes

  • Environmental adaptation: Diversity might reflect adaptation to various bitter compounds in different gorilla populations' diets

The relatively high Tajima's D value (-0.25) for TAS2R20 compared to other TAS2R genes also supports non-neutral evolutionary processes . This pattern contrasts sharply with TAS2R39, which shows minimal nucleotide diversity (0.005%), suggesting different selective pressures on these receptors.

How can researchers effectively analyze the functional differences between gorilla TAS2R20 variants?

A comprehensive approach to analyzing functional differences between gorilla TAS2R20 variants includes:

  • Cell-based functional assays: Express different TAS2R20 variants in heterologous systems (e.g., HEK293T cells) coupled with calcium imaging or FLIPR assays to measure receptor activation by bitter compounds

  • Dose-response analyses: Test receptor variants against a panel of bitter ligands at multiple concentrations to determine EC50 values and maximal responses

  • Mutational analysis: Create targeted mutations at potentially functional residues, particularly in transmembrane domains and extracellular loops, to identify key amino acids for ligand binding and receptor activation

  • Comparative analyses: Compare responses to those of TAS2R20 orthologs from other species, particularly humans and other great apes, to identify species-specific functional differences

  • Structure-function mapping: Map variable sites onto predicted receptor structures to identify functional domains under different selective pressures

Table 1: Distribution of Variable Sites Across TAS2R Receptor Domains

Domain TypeNumber of Variable SitesProportion of PHI SitesFunctional Significance
External Loops (ELs)HighModerateLigand recognition and binding
Transmembrane Domains (TMs)ModerateHighSignal transduction, receptor stability
Internal Loops (ILs)LowLowG-protein coupling, downstream signaling

Note: This distribution pattern is based on general TAS2R structure analysis and specific positions may vary for TAS2R20 .

How does gorilla TAS2R20 compare evolutionarily to homologous receptors in other great apes?

Evolutionary analysis of TAS2R20 across great apes reveals important insights about bitter taste receptor evolution:

  • Nucleotide diversity: Gorilla TAS2R20 shows unusually high nucleotide diversity (0.358%) compared to most bitter taste receptor genes, suggesting unique evolutionary pressures in gorillas

  • Selection signatures: While most TAS2R genes show evidence of purifying selection, TAS2R20 exhibits patterns more consistent with balancing selection or relaxed constraints, as evidenced by its Tajima's D value (-0.25) near neutrality

  • Functional divergence: Variable sites are not randomly distributed across the receptor structure but show patterns suggesting functional specialization in ligand binding regions

  • Ecological correlation: Differences between species likely reflect adaptations to distinct dietary niches and exposure to different plant secondary compounds in their respective habitats

Comprehensive phylogenetic analysis would be required to fully resolve the evolutionary history of this receptor across hominids, including assessment of potential gene conversion events with paralogous receptors.

What genomic techniques are most effective for studying TAS2R20 variation in wild gorilla populations?

The most effective genomic approaches for studying TAS2R20 variation in wild gorilla populations include:

  • Targeted amplicon sequencing: Design primers specific to gorilla TAS2R20 coding regions for cost-effective screening of many individuals

  • Exome capture: Include TAS2R20 and related genes in custom capture arrays to assess variation in the broader bitter taste receptor repertoire

  • Long-read sequencing: Use technologies like PacBio or Oxford Nanopore for haplotype-resolved sequencing of the entire TAS2R gene cluster to detect structural variants

  • Population genomic analysis: Apply metrics such as π, Tajima's D, and FST to identify signatures of selection across populations from different habitats

  • Environmental correlation: Integrate habitat and dietary data to test associations between genetic variants and ecological variables

The high-quality telomere-to-telomere gorilla genome assembly now available provides an excellent reference for these studies, with improved mappability compared to previous assemblies . This is particularly important for TAS2R genes, which often reside in complex genomic regions.

What are the recommended protocols for expressing and purifying recombinant gorilla TAS2R20 for ligand-binding studies?

Recommended Expression and Purification Protocol:

  • Vector selection: Use mammalian expression vectors with strong promoters (CMV) and epitope tags (e.g., FLAG, rho-tag) to facilitate detection and purification

  • Expression system options:

    • For functional studies: HEK293T cells co-transfected with Gα16-gust44 or similar chimeric G-proteins

    • For structural studies: Insect cell systems (Sf9, Hi5) with baculovirus vectors

    • For high-yield production: E. coli systems with specialized membrane protein expression strains

  • Purification approach:

    • Solubilize membranes with mild detergents (DDM, LMNG)

    • Purify using affinity chromatography against the epitope tag

    • Consider adding cholesteryl hemisuccinate to maintain receptor stability

    • Further purify via size exclusion chromatography

  • Storage:

    • Store in buffer containing glycerol at -20°C or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles

    • Maintain working aliquots at 4°C for up to one week

  • Quality control:

    • Verify protein integrity by SDS-PAGE and Western blotting

    • Assess functionality through pilot ligand-binding or activation assays

How can researchers identify and validate potential ligands for gorilla TAS2R20?

A comprehensive approach to identifying and validating potential ligands for gorilla TAS2R20 involves:

  • Preliminary ligand screening:

    • Test compounds known to activate homologous receptors in humans and other primates

    • Screen natural product libraries, particularly plant-derived bitter compounds present in gorilla habitats

    • Use computational docking to predict binding of candidate compounds

  • Functional validation methods:

    • Calcium imaging: Measure intracellular calcium flux in cells expressing TAS2R20

    • FLIPR assays: High-throughput screening of multiple compounds

    • Bioluminescence resonance energy transfer (BRET): Detect conformational changes upon ligand binding

    • Electrophysiology: Direct measurement of receptor activation in specialized setups

  • Dose-response characterization:

    • Determine EC50 values for each active compound

    • Analyze efficacy (maximum response) and potency parameters

    • Identify partial vs. full agonists

  • Antagonist identification:

    • Screen for compounds that block activation by known agonists

    • Characterize competitive vs. non-competitive mechanisms

  • Structure-activity relationship analysis:

    • Test structural analogues to identify critical chemical features

    • Correlate activation patterns with specific molecular properties

How should researchers interpret population genetic data for gorilla TAS2R20 in the context of dietary ecology?

When interpreting population genetic data for gorilla TAS2R20, researchers should consider:

  • Population structure correlation:

    • Compare FST values for TAS2R20 with genome-wide patterns to identify unusual differentiation

    • Test whether genetic clusters correlate with distinct dietary ecotypes of gorillas

  • Selection analysis framework:

    • The high nucleotide diversity (π = 0.358%) and Tajima's D (-0.25) suggest balancing selection or relaxed constraints on TAS2R20

    • Compare these metrics across gorilla subspecies to identify population-specific selection

  • Geographic variation interpretation:

    • Map allele frequencies against ecological zones and plant community composition

    • Test correlations between genetic variants and specific bitter compounds in local plant communities

  • Comparative context:

    • Compare patterns to those in sympatric primate species to distinguish shared environmental pressures from lineage-specific patterns

    • Analyze in context of broader bitter taste receptor evolution in great apes

What are the current challenges in discriminating between functional and neutral variation in gorilla TAS2R20?

Key challenges in discriminating between functional and neutral variation in gorilla TAS2R20 include:

  • Structural complexity:

    • The seven-transmembrane GPCR structure creates complex relationships between sequence and function

    • Critical functional sites may not be obvious from sequence alone

    • Different domains have varying tolerance for mutations

  • Allelic interaction effects:

    • Multiple variants may interact to determine receptor function

    • Haplotypic effects may be more relevant than individual variants

  • Ligand specificity determination:

    • Different variants may affect responses to different bitter compounds

    • Broad vs. narrow tuning properties are difficult to predict from sequence

    • Natural ligands for gorilla TAS2R20 remain largely uncharacterized

  • Methodological limitations:

    • Functional assays have variable sensitivity and may miss subtle effects

    • Heterologous expression systems may lack components present in native cell environments

    • Sample sizes from wild populations are often limited

  • Ecological correlation challenges:

    • Limited data on wild gorilla bitter compound exposure

    • Difficulty quantifying fitness effects of taste perception variation

    • Complex dietary plasticity may obscure genotype-phenotype relationships

Addressing these challenges requires integrating multiple approaches, including comparative genomics, functional assays with diverse ligands, and detailed ecological studies of wild gorilla populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.