Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 38 (TAS2R38)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
TAS2R38; Taste receptor type 2 member 38; T2R38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQPLSNSDCVLLCL SISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSK LIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNT RLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYIRDSRDPSLE AHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAVLISG NAKLRRAVTTILLWAQSSLKVRADHKADSRTPC
Uniprot No.

Target Background

Function

Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 38 (TAS2R38)

This receptor potentially plays a role in bitterness perception and is linked to gustducin. It may also participate in sensing the gastrointestinal tract's chemical composition. Receptor activation may stimulate alpha-gustducin, mediate PLC-beta-2 activation, and subsequently gate TRPM5.

Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the key structural and functional characteristics of TAS2R38 in gorillas compared to humans?

The TAS2R38 receptor belongs to the bitter taste receptor family and is encoded by the TAS2R38 gene. In humans, this receptor mediates the ability to taste phenylthiocarbamide (PTC) and 6-n-propylthiouracil (PROP). The receptor functions through G-protein coupled signaling, specifically utilizing gustducin for signal transduction .

When comparing gorilla and human TAS2R38:

Compared with macaque monkeys (subfamily Cercopithecinae), colobines (leaf-eating monkeys) have demonstrated lower sensitivities to PTC in both behavioral and in vitro functional analyses. Research has identified four non-synonymous mutations in colobine TAS2R38 responsible for this decreased sensitivity to PTC .

How do researchers determine the TAS2R38 diplotypes and how do they differ between populations?

Researchers typically employ the following methodological approaches to determine TAS2R38 diplotypes:

Laboratory Methods:

  • PCR amplification of the TAS2R38 gene region

  • Sanger sequencing or TaqMan SNP Genotyping Assay targeting three key polymorphic sites: rs713598 (A49P), rs1726866 (V262A), and rs10246939 (I296V)

  • Restriction enzyme digestion for rapid genotyping

Key Diplotypes:

  • PAV/PAV: Bitter taster (homozygous functional)

  • AVI/AVI: Bitter non-taster (homozygous non-functional)

  • PAV/AVI: Intermediate bitter taster (heterozygous)

  • Rare haplotypes: AAV, AAI, PVI, AVV

Population differences in TAS2R38 haplotype frequencies are substantial. For example, research has documented significant differences between African American (AA) and Caucasian American (CAU) populations :

PopulationPAV (Bitter)AVI (Non-bitter)AAI (Intermediate)Other Rare
AA (N=304)DominantCommon~1/3 of haplotypesAAV, PVI
CAU (N=201)CommonDominant (~96% combined PAV/AVI)Very rareAAV, AVV

These population differences underscore the importance of considering ethnic diversity in TAS2R38-related research .

What experimental protocols are recommended for functional characterization of recombinant gorilla TAS2R38?

For comprehensive functional characterization of recombinant gorilla TAS2R38, the following experimental protocols are recommended:

Protein Expression and Purification:

  • Express using E. coli, yeast, baculovirus, or mammalian cell systems (depending on research goals)

  • Purify to >85-90% purity as determined by SDS-PAGE

  • For optimal activity, reconstitute protein in deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol as a stabilizer

Functional Assays:

  • In vitro calcium mobilization assays to measure receptor activation by bitter compounds

  • Measurement of cAMP levels following receptor stimulation

  • Binding affinity assays using radiolabeled or fluorescent bitter compounds

  • Cell-based reporter systems to assess receptor-mediated signaling

Researchers should consider the reference protocol from Purba et al. (2017), who performed functional characterization of TAS2R38 bitter taste receptors for PTC in colobine monkeys. Their methodology provides a validated framework for cross-species TAS2R38 functional assessment .

What evidence exists for evolutionary selection pressures on TAS2R38 across primate species?

The evolutionary trajectory of TAS2R38 represents an intriguing example of potential adaptive selection across primate lineages:

Ancient Balancing Selection:

Primate-Specific Adaptations:

  • Research in colobine monkeys demonstrates decreased sensitivity to PTC compared to macaques, suggesting dietary adaptation to leaf consumption

  • This tolerance to bitterness in colobines likely evolved from ancestors sensitive to bitterness as an adaptation to herbivory

The ancestral human haplotype at the three key amino acid positions (Pro49, Ala262, Val296) appears to be PAV, determined by sequencing DNA from various ape species, an old-world monkey, and a new-world monkey. This PAV form is common in humans and associated with tasting ability .

Statistical analyses such as Tajima's D, Li's MFDM, and HKA tests have been applied to detect deviations from neutral evolution. While TAS2R38 shows positive (though not significant) Tajima's D values in coding regions across populations, further analysis using more robust methods failed to detect significant departures from neutrality (MFDM P=0.63, HKA P=0.35) .

How do researchers address potential artifacts or expression challenges when working with recombinant gorilla TAS2R38?

Researchers face several technical challenges when working with recombinant gorilla TAS2R38. The following methodological approaches help address these issues:

Expression System Selection:

  • For functional studies requiring proper folding and post-translational modifications, mammalian expression systems are preferred

  • For structural studies requiring high protein yields, E. coli or yeast systems may be more suitable

  • Baculovirus expression systems offer a compromise between yield and proper folding

Stability Enhancement Strategies:

  • Add 5-50% glycerol to the final preparation (recommended default: 50%)

  • Aliquot and store at -20°C/-80°C to minimize freeze-thaw cycles

  • For working solutions, store at 4°C for up to one week

Purification Considerations:

  • Aim for >85% purity as determined by SDS-PAGE for functional studies

  • For crystallization attempts, higher purity (>95%) is necessary

  • Consider tag selection carefully as it may affect receptor functionality

Quality Control Measures:

  • Verify protein identity using mass spectrometry

  • Assess functional integrity with ligand binding assays

  • Confirm proper folding via circular dichroism spectroscopy

What are the implications of TAS2R38 genetic variation for extraoral physiological functions?

Recent research has revealed that TAS2R38 functions extend far beyond taste perception, with important implications for multiple physiological systems:

Respiratory System:

  • TAS2R38 receptors appear as innovative regulators of innate immunity in the respiratory system

  • Single nucleotide polymorphisms (SNPs) in TAS2R38 may contribute to individual differences in susceptibility to respiratory infections, particularly chronic rhinosinusitis (CRS)

  • The protective genotype (PAV/PAV) has been associated with lower average CT score compared to AVI/AVI genotypes (p=0.01)

Gastrointestinal Health:

  • TAS2R38 variants have been investigated for potential associations with gastrointestinal neoplasms

  • A meta-analysis of five articles including eight studies found minimal modification of GI neoplasm risk by TAS2R38 diplotype

  • The odds ratios for various genetic models were: AVI vs. PAV: OR = 1.03 (95%CI: 0.97–1.09), AVI/PAV vs. PAV/PAV: OR = 1.05, (95%CI: 0.94–1.17), AVI/* vs. PAV/PAV: OR = 1.04 (95%CI: 0.94–1.16)

Longevity:

  • Research has found evidence associating TAS2R38 genetic variants with exceptional longevity

  • A study of centenarian and near-centenarian subjects showed an increased frequency of the PAV/PAV genotype and decreased frequency of AVI/AVI compared to control cohorts

  • This suggests TAS2R38 bitter receptor may be involved in the molecular physiological mechanisms of aging

These findings highlight the importance of considering TAS2R38 beyond its role in taste perception when designing research studies with recombinant TAS2R38 proteins from various species.

How can researchers design comparative studies between gorilla and human TAS2R38 to investigate functional differences?

Designing rigorous comparative studies between gorilla and human TAS2R38 requires careful methodological consideration:

Experimental Design Framework:

  • Express both recombinant proteins using identical systems (preferably mammalian cells for functional studies)

  • Ensure comparable protein purity and concentration

  • Test against a standardized panel of bitter compounds, including PTC and PROP

  • Include appropriate positive and negative controls

Functional Comparison Methodologies:

  • Dose-response curves for various ligands to determine EC50 values

  • Calcium imaging to assess receptor activation kinetics

  • Competitive binding assays to compare receptor affinity for shared ligands

  • Mutagenesis studies targeting key residues that differ between species

Data Analysis and Interpretation:

  • Use statistical models that account for species-specific receptor expression levels

  • Consider physiological relevance of any observed functional differences

  • Contextualize findings with ecological and dietary knowledge of each species

For the most robust results, researchers should consider the approach used by Purba et al. (2017), who conducted comprehensive functional characterization of TAS2R38 receptors across multiple primate species to examine evolutionary adaptations in bitter taste perception .

What methodological approaches can address the challenge of correlating TAS2R38 genotypes with dietary behaviors across species?

Investigating correlations between TAS2R38 genotypes and dietary behaviors across species presents unique methodological challenges:

Research Design Considerations:

  • Employ mixed-methods approaches combining genetic, behavioral, and ecological data

  • Utilize longitudinal designs to capture temporal variations in dietary preferences

  • Control for confounding variables such as food availability and social influences

Cross-Species Dietary Assessment:

  • Standardize dietary preference measurements using comparable food items across species

  • Implement observational protocols to document natural feeding behaviors

  • Consider species-specific dietary adaptations when interpreting results

Statistical Analysis Strategies:

  • Use mixed effects models to test for differences in feeding behavior between genotype groups over time

  • Apply principal components analysis to determine if variants in related T2R genes associate with dietary behaviors

  • Consider interaction effects between genotype and environmental factors

Human studies have demonstrated that TAS2R38 diplotypes can influence responses to dietary interventions. For example, research showed that after six months of nutrition counseling, vegetable consumption frequency differed based on bitter taste diplotypes (P=0.046). Within the enhanced intervention group, bitter non-tasters and intermediate-bitter tasters showed the largest increase in vegetable consumption, while bitter tasters in the minimal intervention group reported decreased consumption .

How do researchers investigate the binding specificity of gorilla TAS2R38 to various bitter compounds?

To thoroughly investigate the binding specificity of gorilla TAS2R38 to various bitter compounds, researchers employ multiple complementary approaches:

Ligand Binding Assays:

  • Competitive binding assays using radiolabeled or fluorescent ligands

  • Surface plasmon resonance (SPR) to measure real-time binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

Functional Response Measurements:

  • Calcium mobilization assays in heterologous expression systems

  • BRET/FRET-based assays to detect conformational changes upon ligand binding

  • Electrophysiological recordings in taste receptor cells expressing the recombinant receptor

Computational Modeling:

  • Homology modeling based on known GPCR structures

  • Molecular docking simulations with potential ligands

  • Molecular dynamics simulations to understand binding pocket flexibility

Structure-Activity Relationship Analysis:

  • Systematic testing of structurally related bitter compounds

  • Comparison of binding affinities across a chemical series

  • Identification of essential chemical moieties for receptor activation

To date, 23 distinct ligands have been identified for the human T2R38 bitter taste receptor . Notable ligands include PTC, PROP, limonin (found in citrus fruits), cyclamate (an artificial sweetener), and chlorpheniramine (an antihistamine) . Comparative studies with gorilla TAS2R38 could reveal species-specific differences in ligand recognition profiles.

What are the most robust methods for analyzing evolutionary signatures in TAS2R38 across primate lineages?

For rigorous analysis of evolutionary signatures in TAS2R38 across primate lineages, researchers should implement a comprehensive methodological approach:

Sequence-Based Methods:

  • Calculate standard population genetic statistics:

    • Tajima's D (tests for deviations from neutral evolution)

    • Li's MFDM (robust to confounding demographic effects)

    • HKA test (compares polymorphism and divergence patterns)

  • Assess linkage disequilibrium patterns and haplotype structure

Comparative Genomic Approaches:

  • Construct phylogenetic trees of TAS2R38 sequences across primates

  • Estimate nonsynonymous/synonymous substitution ratios (dN/dS)

  • Identify lineage-specific acceleration or constraint

Population-Level Analysis:

  • Compare TAS2R38 haplotype frequencies across multiple primate populations

  • Test for signatures of selective sweeps or balancing selection

  • Evaluate evidence for convergent evolution in species with similar dietary niches

Previous studies have employed these methods to investigate TAS2R38 evolution. For example, analysis of the TAS2R38 locus in humans found positive but not significant Tajima's D values in all populations examined (P>0.05). When compared to genome-wide Tajima's D values for coding loci of similar size, TAS2R38 values fell between the 5th and 95th percentiles . Additional tests including Li's MFDM (P=0.63) and HKA (P=0.35) also failed to detect significant departures from neutrality in recent human evolution .

What controls should be included when conducting functional studies with recombinant gorilla TAS2R38?

For rigorous functional studies with recombinant gorilla TAS2R38, the following controls are essential:

Positive Controls:

  • Well-characterized bitter taste receptors (e.g., human TAS2R38 with known functional responses)

  • Known agonists with established dose-response relationships (PTC, PROP)

  • Cell lines with endogenous expression of taste signaling components

Negative Controls:

  • Mock-transfected cells (vector only)

  • Non-bitter compounds structurally similar to test compounds

  • Mutated receptor versions lacking key functional residues

  • Receptor-expressing cells with signaling pathway inhibitors

Experimental Validation Controls:

  • Expression level verification (Western blot, immunofluorescence)

  • Cellular localization confirmation (membrane trafficking)

  • Signal transduction pathway functionality assessment

  • Multiple biological and technical replicates

Cross-Species Comparison Controls:

  • Human TAS2R38 variants (PAV, AVI) expressed under identical conditions

  • Other primate TAS2R38 receptors to establish evolutionary context

  • Other TAS2R family members to confirm specificity of responses

The inclusion of these comprehensive controls will enhance the reliability and interpretability of functional data obtained with recombinant gorilla TAS2R38.

How can researchers address challenges in correlating in vitro findings with in vivo taste perception across species?

Bridging the gap between in vitro receptor studies and in vivo taste perception presents significant methodological challenges:

Experimental Approach Integration:

  • Combine heterologous expression systems with ex vivo tissue preparations

  • Correlate cellular responses with nerve recordings from taste papillae

  • Develop animal models expressing gorilla TAS2R38 variants

Translational Behavioral Methods:

  • Design species-appropriate preference tests for bitter compounds

  • Implement conditioned taste aversion paradigms where ethically applicable

  • Use facial reactivity measurements as proxy for taste perception

Physiological Context Reconstruction:

  • Recreate the cellular environment of taste receptor cells in vitro

  • Consider co-expression with taste signaling partners (G-proteins, ion channels)

  • Account for species differences in taste bud structure and innervation

Data Integration Framework:

  • Develop mathematical models relating receptor activation to perceived intensity

  • Implement multivariate analyses incorporating genetic, physiological, and behavioral data

  • Consider evolutionary context when interpreting cross-species differences

Research has shown that in colobine monkeys, decreased sensitivity to PTC in behavioral analyses corresponds with functional differences in their TAS2R38 receptors measured in vitro . This alignment between behavioral and molecular data provides a valuable model for similar studies with gorilla TAS2R38.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.