Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 41 (TAS2R41)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Gorilla gorilla gorilla TAS2R41

Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 41 (TAS2R41) is a laboratory-engineered protein produced by expressing the TAS2R41 gene from the Western lowland gorilla in heterologous systems such as E. coli. This bitter taste receptor belongs to the TAS2R family of G protein-coupled receptors (GPCRs), which detect bitter compounds and initiate signaling cascades influencing taste perception, metabolic regulation, and immune responses .

Bitter Signal Transduction

TAS2R41 activates a dual-pathway cascade upon ligand binding:

  1. PLCβ2 pathway: Mediated by Gβγ subunits, leading to calcium release and depolarization .

  2. PDE1A pathway: Modulated by Gα-gustducin, reducing cAMP levels to amplify signaling .

Extra-Oral Functions

Beyond taste perception, TAS2R41 is implicated in:

  • Gut-endocrine responses (e.g., gastric emptying regulation) .

  • Airway immune responses to inhaled irritants .

Evolutionary Insights

  • Primate-specific expansion: TAS2R41 is part of a gene family that expanded rapidly in primates, correlating with dietary adaptations .

  • Amphibian comparisons: While amphibians exhibit extensive TAS2R diversification (e.g., Eleutherodactylus coqui has 39 TAS2R clusters), gorilla TAS2R41 retains structural simplicity (single exon, ~1 kb length) .

Ligand Specificity

Although direct ligands for gorilla TAS2R41 remain uncharacterized, studies on human TAS2R16 suggest that:

  • Critical residues (e.g., W261, S273) in transmembrane domains determine ligand specificity .

  • Evolutionary conservation of signaling residues (e.g., N89, E262) across TAS2Rs implies shared activation mechanisms .

Expression Patterns

  • Tissue specificity: In amphibians, expanded TAS2Rs are expressed in non-oral tissues like skin and intestines . Gorilla TAS2R41 likely follows similar extra-oral expression trends, though empirical data are pending.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TAS2R41; Taste receptor type 2 member 41; T2R41
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
MQAALMAFFMLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGASRXCLQL VGTVHNFYYSARKVEYSGGLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHPTFL WLKWRFPGWVPWLLLGSVLISFIITLLFFWVNYPVYQELLIRKFSGNMTYKWNTRIETYY FPSLKLVIWSIPFSVFLVSIMLLINSLRRHTQRMQHNGHSLQDPSTQAHTRALKSLISFL FLYALSFLSLIIDATKFISMQNDFYWPWQIAVYLCISVHPFILIFSNLKLRSMFWQVLLL ARGFWVA
Uniprot No.

Target Background

Function

A receptor potentially involved in bitterness perception and linked to gustducin. It may play a role in sensing gastrointestinal chemical composition. Activation of this receptor may stimulate alpha-gustducin, mediate PLC-beta-2 activation, and subsequently gate TRPM5.

Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R41 and what is its functional significance in taste perception?

TAS2R41 belongs to the taste receptor type 2 (TAS2R) family responsible for bitter taste perception. Unlike more promiscuous bitter receptors that respond to multiple compounds, TAS2R41 shows high selectivity in ligand binding, having only one identified agonist in humans according to recent studies . This narrow tuning suggests that TAS2R41 evolved to detect specific bitter compounds potentially relevant to dietary selection or toxin avoidance.

Methodologically, researchers characterizing TAS2R41 function should employ calcium-flux assays in heterologous expression systems where the receptor is coupled to chimeric G proteins. This approach allows for quantification of receptor activation in response to potential bitter compounds. When conducting such assays, it is critical to include positive controls with known TAS2R agonists and to verify receptor expression through immunocytochemistry using epitope tags that do not interfere with signaling function, such as the HSV glycoprotein D epitope system described in previous studies of TAS2Rs .

How does recombinant gorilla TAS2R41 differ structurally from human TAS2R41?

Gorilla TAS2R41 shares significant sequence homology with human TAS2R41, though with species-specific variations that may influence ligand binding properties and signaling efficiency. The commercially available recombinant gorilla TAS2R41 is typically produced with N-terminal epitope tags to facilitate detection and purification, similar to the His-tagged recombinant TAS2R4 protein described in the search results .

When comparing gorilla and human TAS2R41, researchers should employ multiple sequence alignment tools to identify conserved transmembrane domains and variable extracellular regions. Homology modeling based on other G protein-coupled receptors can help predict structural differences that might influence ligand binding. For functional comparisons, it is advised to express both human and gorilla variants in the same cellular background under identical conditions to minimize experimental variables that could confound interpretation.

What expression systems are most effective for producing functional recombinant gorilla TAS2R41?

The methodological approach should consider that TAS2Rs can show variable expression efficiency and cellular localization. Previous studies with other TAS2Rs have reported that some receptors show reduced expression efficiency (3-15% of cells) or may localize primarily intracellularly rather than at the plasma membrane . Therefore, researchers should optimize transfection protocols and consider using inducible expression systems to control expression levels. Verification of proper trafficking to the plasma membrane through confocal microscopy with membrane markers (such as ConA staining) is essential before conducting functional assays.

What methodological challenges exist in functional characterization of gorilla TAS2R41?

Several methodological challenges complicate the functional characterization of gorilla TAS2R41. The first major challenge involves achieving sufficient plasma membrane expression. As observed with other TAS2R family members, TAS2R41 may show variable expression efficiency and predominant intracellular localization , which can complicate functional assays that require cell surface expression.

To address this challenge, researchers should:

  • Optimize codon usage for the expression system

  • Consider using specific trafficking enhancers or chaperones

  • Test multiple N-terminal epitope tags to identify constructs with optimal surface expression

  • Employ trafficking-enhancing signal sequences

Another significant challenge is the identification of agonists. Given that human TAS2R41 has only one known agonist , researchers should employ high-throughput screening approaches with large libraries of bitter compounds, both natural and synthetic. Additionally, considering the evolutionary context of gorilla dietary preferences might provide insights into potential species-specific ligands that would not be apparent from human studies alone.

How can researchers effectively compare TAS2R41 function across primate species to understand evolutionary adaptations?

Comparative analysis of TAS2R41 across primate species requires a carefully designed phylogenetic framework. Researchers should:

  • Sequence TAS2R41 from multiple primate species representing different evolutionary lineages

  • Calculate selection metrics such as dN/dS ratios to identify regions under positive or balancing selection

  • Conduct sliding-window analysis to detect specific nucleotide variants that might be functionally significant

The evolutionary patterns observed for other TAS2Rs provide instructive examples. For instance, TAS2R38 shows independent evolution of taste sensitivity in humans and chimpanzees through different molecular mechanisms . Similarly, TAS2R2 has shown evidence of ancient balancing selection in humans, with positive Tajima's D values and significant HKA test results .

Functionally, researchers should express TAS2R41 variants from different species in identical cellular backgrounds and test their responses to a standardized panel of bitter compounds. This approach allows direct comparison of receptor sensitivity and specificity across species, revealing how molecular changes correlate with functional adaptations.

What molecular techniques are most effective for studying TAS2R41 polymorphisms in gorilla populations?

Studying TAS2R41 polymorphisms in gorilla populations requires comprehensive sampling and sensitive genotyping techniques. Researchers should:

  • Collect DNA samples from multiple gorilla subspecies and populations

  • Amplify the TAS2R41 coding region using high-fidelity polymerase to minimize PCR-induced errors

  • Employ both direct sequencing and next-generation sequencing approaches to identify rare variants

For population genetic analysis, calculating metrics such as Tajima's D, Fu and Li's D and F, and Fay and Wu's H statistics can reveal signatures of selection. Previous studies with human TAS2Rs have used these approaches to identify receptors under balancing selection . Additionally, the HKA test can be useful for comparing polymorphism and divergence between gorillas and outgroup species.

For functional validation of identified polymorphisms, researchers should recreate the variants through site-directed mutagenesis and compare their functional properties in standardized assays. This approach has successfully linked genetic polymorphisms to functional differences in other TAS2Rs, such as the well-characterized case of TAS2R38 and PTC sensitivity .

How can researchers design experiments to identify potential agonists for gorilla TAS2R41?

Identifying agonists for gorilla TAS2R41 requires systematic screening approaches. Researchers should:

  • Express gorilla TAS2R41 in a cell line with minimal endogenous bitter receptor expression, such as HEK293T cells

  • Co-express promiscuous G-proteins (e.g., Gα16gust44) to couple receptor activation to calcium signaling

  • Establish a functional assay system using calcium-sensitive fluorescent dyes or genetically encoded calcium indicators

The experimental design should include a tiered approach:

  • Initial screening with a diverse library of bitter compounds at high concentrations

  • Secondary screening with structural analogs of compounds showing activity

  • Dose-response analysis of confirmed hits to determine EC50 values

  • Verification using multiple assay systems to eliminate false positives

Previous research with "orphan" TAS2Rs suggests that high selectivity rather than expression issues may explain the difficulty in finding agonists . Therefore, researchers should consider compounds from gorilla dietary items, particularly plant secondary metabolites from food sources consumed by gorillas in their natural habitat.

What approaches are recommended for investigating TAS2R41 signaling pathways in taste cells?

Investigating TAS2R41 signaling pathways requires techniques that bridge in vitro and in vivo systems. While heterologous expression systems provide convenient platforms for initial characterization, they may not recapitulate the complete signaling environment of native taste cells.

Researchers should consider:

  • Developing primary culture methods for gorilla taste cells, though this presents ethical and practical challenges

  • Using transgenic mouse models expressing gorilla TAS2R41 in taste cells

  • Employing organoid culture systems derived from tongue epithelium

For signaling pathway dissection, researchers should systematically investigate:

  • G-protein coupling specificity using siRNA knockdown of candidate G-proteins

  • Downstream effectors using pharmacological inhibitors and genetic approaches

  • Potential interaction with other taste signaling components through co-immunoprecipitation

When comparing signaling mechanisms across species, it's important to consider that even closely related receptors may couple to different downstream pathways or show species-specific interactions with signaling components, as has been observed with other taste receptors.

Future Research Directions for Gorilla TAS2R41 Studies

Future research on gorilla TAS2R41 should prioritize ecological and evolutionary contexts. Understanding how receptor function relates to natural dietary preferences and toxin avoidance behaviors would provide important insights into the selective pressures shaping TAS2R41 evolution.

Additionally, comparative studies across great ape species could reveal whether the narrow tuning observed in human TAS2R41 is conserved across the lineage or represents a species-specific adaptation. The evidence for balancing selection in other TAS2Rs suggests that bitter taste receptors represent important adaptations to environmental challenges .

Finally, integrating structural biology approaches, including cryo-EM or computational modeling based on recently solved GPCR structures, could provide mechanistic insights into how sequence variations between species translate to functional differences in ligand binding and receptor activation.

Storage and Handling Recommendations for Recombinant TAS2R41

Proper storage and handling of recombinant gorilla TAS2R41 is critical for maintaining protein integrity and experimental reproducibility. Based on manufacturer recommendations, researchers should store the protein at -20°C for regular use or -80°C for long-term storage . Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles that can compromise protein structure.

For reconstitution of lyophilized protein, sterile deionized water is recommended to achieve a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol as a cryoprotectant . Researchers should centrifuge vials briefly before opening to ensure all material is collected at the bottom.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.