Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 7 (TAS2R7)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant TAS2R7 is generated through bacterial expression and purified via affinity chromatography. Critical steps include:

  • Expression: Optimized in E. coli for high yield .

  • Tagging: His tag facilitates nickel-based purification .

  • Stability: Repeated freeze-thaw cycles are discouraged; storage at -80°C in 50% glycerol preserves functionality .

Functional Insights

TAS2R7 detects bitter compounds, initiating signaling cascades via Gα proteins (e.g., Gustducin). Key findings:

  • Ligand Specificity: Activated by anthocyanins like malvidin-3-glucoside .

  • Evolutionary Role: TAS2R receptors emerged ~430 million years ago, coinciding with plant diversification, suggesting co-evolution with toxin detection .

  • Genetic Variants: Polymorphisms (e.g., rs619381) modulate receptor activity and bitter perception .

Table 2: Pathway Involvement

PathwayAssociated Proteins/Genes
Taste TransductionGNAT3, PLCβ2, TRPM5, TAS2R13, TAS2R16
GPCR SignalingGα subunits, PKA, Phospholipase C
Bitter Compound SensingAnthocyanins, alkaloids, toxins

Research Applications

  • Comparative Studies: TAS2R7 haplotypes in avian species (e.g., chickens) reveal adaptive bitter sensing mechanisms .

  • Structural Biology: Despite lacking resolved structures, homology modeling leverages conserved GPCR motifs .

  • Pharmacology: Screens for TAS2R7 modulators aim to manipulate taste perception or treat metabolic disorders .

Challenges and Future Directions

  • Structural Data: No experimental structures exist; cryo-EM or crystallography efforts are needed .

  • Ligand Discovery: High-throughput assays could identify novel agonists/antagonists .

  • Evolutionary Analysis: Cross-species comparisons (e.g., primates vs. birds) clarify bitter receptor diversification .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare your order according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R7; Taste receptor type 2 member 7; T2R7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Target Names
Target Protein Sequence
MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLC IILLDCFTLVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFKIGNFFHPLFL WMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHA STKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISF LLLFIAYYLSFLIATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRYVSLKVI WKVMSILKGRKFQQHKQI
Uniprot No.

Target Background

Function
Gustducin-coupled receptor involved in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the functional role of TAS2R7 in Gorilla gorilla gorilla?

TAS2R7 functions as a bitter taste receptor in Western lowland gorillas, belonging to the TAS2R family of G protein-coupled receptors. It mediates bitter taste perception by initiating signal transduction cascades upon binding bitter compounds. This receptor plays a crucial role in the gorilla's ability to detect potentially toxic compounds in food sources, allowing them to avoid harmful substances in their plant-based diet . Beyond oral taste perception, TAS2R7 likely serves additional roles in extraoral tissues, particularly in the gut and airways, where it may mediate responses to nutrients, bacterial compounds, and environmental substances, potentially contributing to immune function and digestive processes .

How is recombinant Gorilla gorilla gorilla TAS2R7 protein produced for research purposes?

Recombinant Gorilla gorilla gorilla TAS2R7 is typically produced using E. coli expression systems. The full-length protein (amino acids 1-318) is expressed with an N-terminal His-tag to facilitate purification . The production process involves:

  • Cloning the TAS2R7 gene sequence into a suitable bacterial expression vector

  • Transforming the construct into E. coli host cells

  • Inducing protein expression under controlled conditions

  • Lysing the cells and purifying the protein using affinity chromatography targeting the His-tag

  • Processing into a lyophilized powder for stability and storage

The resulting protein preparation typically achieves >90% purity as determined by SDS-PAGE and can be reconstituted in deionized sterile water to concentrations of 0.1-1.0 mg/mL for experimental use .

How should recombinant TAS2R7 protein be stored and handled for optimal stability?

Recombinant TAS2R7 protein requires specific storage and handling conditions to maintain its structural integrity and functional activity:

  • Long-term storage: Store the lyophilized powder at -20°C or -80°C

  • Reconstitution: Briefly centrifuge the vial before opening, then reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Working solution preparation: Add glycerol to a final concentration of 5-50% (optimally 50%) and aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots: Store at 4°C for up to one week

  • Buffer conditions: The protein is stabilized in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided. For research reproducibility, all handling steps should be documented with consistent protocols across experiments .

How does Gorilla gorilla gorilla TAS2R7 differ from human TAS2R7 in terms of ligand specificity and sensitivity?

Gorilla gorilla gorilla TAS2R7 and human TAS2R7 exhibit distinct ligand specificity profiles despite their evolutionary relatedness. Functional comparison studies using cell-based assays reveal that:

  • Receptor response patterns: The gorilla TAS2R7 typically responds to a narrower range of bitter compounds compared to its human ortholog, likely reflecting dietary specialization in the largely herbivorous gorilla

  • Activation thresholds: Gorilla TAS2R7 shows higher sensitivity (lower EC50 values) to plant-derived bitter compounds common in forest vegetation, particularly certain alkaloids and glycosides found in their natural diet

  • Molecular determinants: Key amino acid differences in the binding pocket and transmembrane domains between gorilla and human TAS2R7 account for these functional differences

When examining response profiles across multiple compounds, research indicates that gorilla TAS2R7 exhibits stronger responses to compounds from plants in their native habitat. This observation supports the evolutionary theory that bitter taste receptor repertoires adapt to ecological niches and feeding strategies . Notably, TAS2R7 shows greater conservation across great apes compared to some other TAS2R family members that have undergone more rapid evolution, suggesting important functional constraints on this particular receptor .

What evolutionary pressures shaped TAS2R7 conservation in Gorilla gorilla gorilla compared to other TAS2R family members?

TAS2R7 shows remarkable conservation in Gorilla gorilla gorilla compared to other TAS2R family members, suggesting distinct evolutionary pressures:

  • Purifying selection: Unlike TAS2R38 and TAS2R16 which show evidence of balancing selection in humans, TAS2R7 exhibits minimal variation (Wang et al. found 0 changes), indicating strong purifying selection maintaining its function

  • Dietary specialization: The conservation of TAS2R7 likely reflects its importance in detecting specific compounds critical for gorillas' herbivorous diet, particularly toxins found in their forest vegetation

  • Extra-oral functions: The conservation may also relate to its roles beyond taste perception, such as in gut immunity and microbial sensing, which are vital for health maintenance in a species consuming high-fiber plant diets

The evolutionary pattern of TAS2R7 contrasts with the broader TAS2R family trend, where repertoire size typically correlates with the proportion of plants in a species' diet . While gorillas have expanded bitter taste receptor repertoires as herbivores, TAS2R7 specifically appears under stronger functional constraints than other family members. This suggests it may detect compounds that remained consistently important throughout gorilla evolution, rather than responding to shifting dietary toxin profiles .

How do experimental models using recombinant TAS2R7 compare in efficacy for bitter compound screening?

Experimental models for bitter compound screening using recombinant TAS2R7 vary significantly in their efficacy and information yield:

Experimental ModelAdvantagesLimitationsOptimal Applications
Heterologous cell expression (HEK293)High throughput, controlled environment, quantifiable dose-responseLacks cellular context of taste cells, possible interference from endogenous signalingInitial screening of large compound libraries
Taste cell culture with transfected TAS2R7More physiologically relevant, maintains taste cell machineryLimited lifespan, variable expression levels, technically challengingVerification of hits from primary screens
In vitro reconstitution with purified proteinDirect binding measurements, structural insightsRequires stable functional protein, loses cellular signaling contextMechanistic studies of receptor-ligand interactions
Organoid models3D cellular context, multiple cell typesLower throughput, complex analysis, variable developmentComplex interaction studies between cell types

For optimal results, a multi-model approach is recommended, beginning with high-throughput cell-based screening to identify potential ligands, followed by validation in more physiologically relevant systems. The choice of model significantly impacts results, particularly when comparing across species, as different experimental systems may introduce variable bias in receptor function assessment .

What methodological challenges exist when studying TAS2R7 signal transduction pathways in non-human primates?

Studying TAS2R7 signal transduction pathways in non-human primates presents several methodological challenges:

  • Species-specific pathway components: While TAS2R7 signals through G protein-coupled pathways similar to other bitter taste receptors, subtle differences in downstream effectors between humans and gorillas require careful validation of pathway components

  • Tissue access limitations: Obtaining fresh taste tissue samples from gorillas is ethically and practically restricted, necessitating alternative approaches such as:

    • Development of immortalized gorilla taste cell lines

    • Use of induced pluripotent stem cells (iPSCs) differentiated into taste cell lineages

    • Creation of chimeric systems with gorilla TAS2R7 in human cellular backgrounds

  • Pathway reconstitution challenges: The complete bitter taste transduction cascade involves multiple proteins beyond TAS2R7, including specific G-protein subunits (gustducin), phospholipase C-β2, and TRPM5 channels

  • Validation requirements: Findings from recombinant systems require validation through:

    • Comparative calcium imaging assays

    • Phosphorylation studies of downstream targets

    • Selective pathway inhibitor approaches

Researchers must carefully design control experiments accounting for species differences in signal transduction components when interpreting functional data from gorilla TAS2R7 studies .

What functional assays are most appropriate for characterizing ligand interactions with recombinant TAS2R7?

Multiple functional assays can be employed to characterize ligand interactions with recombinant TAS2R7, each with specific advantages for different research questions:

  • Calcium mobilization assays:

    • Principle: Measures changes in intracellular calcium as a proxy for receptor activation

    • Methodology: Cells expressing TAS2R7 are loaded with calcium-sensitive fluorescent dyes (Fluo-4, Fura-2) and exposed to potential ligands

    • Advantages: Real-time kinetic data, dose-response relationships, relatively high throughput

    • Limitations: Indirect measure of receptor activation, potential interference from endogenous signaling

  • Binding assays with purified receptor:

    • Principle: Direct measurement of ligand binding to purified receptor protein

    • Methodology: Surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), or fluorescence-based binding assays

    • Advantages: Direct binding kinetics, thermodynamic parameters, no cellular context required

    • Applications: Structure-activity relationship studies, binding site identification

  • Conformational change assays:

    • Principle: Measurement of receptor conformational changes upon ligand binding

    • Methodology: FRET-based sensors with fluorophores at strategic positions in the receptor

    • Advantages: Detects subtle binding events even without full activation, structural insights

    • Applications: Allosteric modulator identification, partial agonist characterization

For comprehensive characterization, a multi-assay approach is recommended, starting with cellular activation assays followed by more detailed binding and conformational studies for promising ligands .

How can researchers address the challenges of producing functional membrane proteins like TAS2R7 for structural studies?

Producing functional membrane proteins like TAS2R7 for structural studies presents significant challenges that can be addressed through specialized approaches:

  • Expression system optimization:

    • E. coli: While commonly used , often produces inclusion bodies requiring refolding

    • Alternative systems: Insect cells (Sf9, High Five), mammalian cells (HEK293), or cell-free systems often yield better-folded GPCRs

    • Codon optimization: Adapting the TAS2R7 gene sequence to the expression host's codon bias improves yield

  • Stabilization strategies:

    • Fusion partners: Adding well-folding proteins (BRIL, T4 lysozyme) to N- or C-terminus improves stability

    • Thermostabilizing mutations: Systematic alanine scanning to identify mutations that enhance thermal stability

    • Nanodiscs or amphipols: Membrane-mimetic environments that maintain native conformation after extraction

  • Purification optimization:

    • Detergent screening: Testing multiple detergents (DDM, LMNG, GDN) to identify optimal extraction conditions

    • Lipid supplementation: Adding specific lipids during purification preserves function

    • Ligand addition: Purifying in the presence of a high-affinity ligand often stabilizes the receptor

  • Quality control metrics:

    • Size-exclusion chromatography profiles: Monodisperse peaks indicate properly folded protein

    • Circular dichroism: Confirms appropriate secondary structure content

    • Functional binding assays: Verify ligand binding capability of purified protein

By systematically addressing these challenges, researchers can obtain sufficient quantities of functional TAS2R7 suitable for structural studies using techniques such as cryo-electron microscopy or X-ray crystallography .

What comparative genomic approaches are most informative for understanding TAS2R7 evolution across primate species?

To understand TAS2R7 evolution across primate species, several comparative genomic approaches yield complementary insights:

  • Phylogenetic analysis:

    • Maximum likelihood and Bayesian methods to reconstruct evolutionary relationships of TAS2R7 sequences

    • Assessment of branch lengths and topological concordance with species trees

    • Identification of lineage-specific accelerations or constraints in TAS2R7 evolution

  • Selection pressure analysis:

    • Calculation of dN/dS ratios (ω) to detect positive selection, purifying selection, or neutral evolution

    • Site-specific models (PAML, HyPhy) to identify specific amino acid positions under selection

    • Branch-site tests to detect episodic selection on specific lineages

  • Functional domain conservation mapping:

    • Identification of highly conserved motifs across primates indicating functional constraints

    • Mapping of variable regions potentially associated with species-specific ligand recognition

    • Correlation of sequence variation with ecological and dietary differences

  • Population genomic approaches:

    • Analysis of intraspecific variation in TAS2R7 within gorilla populations

    • Assessment of derived allele frequencies and haplotype structures

    • Identification of recent selective sweeps or balanced polymorphisms

Evidence from comparative studies indicates that TAS2R7 shows remarkable conservation across great apes compared to other TAS2R family members, suggesting important functional constraints . This conservation pattern contrasts with the broader evolutionary pattern of TAS2Rs, where repertoire size typically correlates with herbivory and diet breadth .

What are the future research directions for Gorilla gorilla gorilla TAS2R7 and its potential applications in comparative sensory biology?

Future research on Gorilla gorilla gorilla TAS2R7 holds promise in several key directions:

  • Structural biology advancements:

    • Determination of the first high-resolution structure of gorilla TAS2R7 using cryo-EM or X-ray crystallography

    • Comparative structural analysis with human TAS2R7 to identify species-specific binding pocket differences

    • Structure-guided design of species-selective compounds for behavioral studies

  • Ecological and behavioral correlations:

    • Field studies correlating TAS2R7 ligands with gorilla feeding preferences in natural habitats

    • Comparative taste perception tests across great apes to map receptor function to dietary specialization

    • Investigation of potential connections between TAS2R7 function and medicinal plant selection by gorillas

  • Extraoral function characterization:

    • Exploration of TAS2R7's role in gorilla gut immune function and microbiome interactions

    • Investigation of potential pathogen detection capabilities via bacterial quorum-sensing molecules

    • Comparative analysis of extraoral expression patterns across primate species

  • Applied research potential:

    • Development of bioassays using gorilla TAS2R7 to screen for novel bitter compounds in plant biodiversity studies

    • Investigation of convergent and divergent bitter perception across species for evolutionary insight

    • Comparative pharmacology studies to understand species differences in drug responses mediated by TAS2Rs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.