VN1R5 belongs to the vomeronasal receptor family, which is primarily associated with pheromone detection and chemosensory signaling. In primates, these receptors are often pseudogenized or functionally divergent compared to other mammals. The recombinant version of VN1R5 is produced in E. coli and includes a His-tag for purification and detection. While its physiological role in gorillas remains unclear, it serves as a critical tool for studying receptor evolution and function in non-human primates .
Host System: Expressed in E. coli using recombinant DNA technology .
Tag: N-terminal 10xHis-tag for affinity chromatography and western blot detection .
Protein Length: Full-length sequence spanning amino acids 1–357 .
Sequence: Partial amino acid sequence includes motifs such as MLKLVIIENMAEIMLFSLDLLLFSTDILCFNFPSKMIKLPGFITIQIFFYPQASFGIS... (full sequence available in product documentation) .
While no direct functional studies on the gorilla VN1R5 recombinant protein are reported, its structure aligns with canonical vomeronasal receptors. Human VN1R5 homologs have been implicated in:
Cisplatin Resistance: Upregulated in head and neck squamous cell carcinoma (HNSCC) and linked to DNA repair via lnc-POP1-1/MCM5 interaction .
Signal Transduction: Potential activation of cAMP/PKA pathways, though this remains unconfirmed in gorillas .
The recombinant VN1R5 is primarily used in:
KEGG: ggo:101153670
Vomeronasal type-1 receptor 5 (VN1R5), also known as V1r-like receptor 5, is a G-protein coupled receptor expressed in the vomeronasal organ. In gorillas, as in other mammals, vomeronasal receptors are involved in chemical communication and pheromone detection. The receptor is encoded by the VN1R5 gene (synonym: V1RL5) and comprises 357 amino acids forming a complete functional protein. VN1R5 belongs to the broader V1r gene superfamily, which has undergone significant evolutionary changes across mammalian lineages .
Recombinant VN1R5 protein should be stored at -20°C for routine use or at -80°C for extended storage. The protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized for protein stability. Working aliquots may be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity. For experimental applications, it is advisable to thaw aliquots on ice and handle the protein using appropriate laboratory techniques to prevent contamination and degradation .
For ELISA applications with recombinant VN1R5, researchers should follow these methodological steps:
Plate Preparation: Coat high-binding ELISA microplates with anti-tag antibodies corresponding to the tag present on the recombinant VN1R5 (tag type is determined during production process).
Protein Dilution: Dilute the recombinant VN1R5 (typically supplied as 50 μg) in an appropriate buffer (PBS with 1% BSA is often suitable).
Standard Curve Generation: Prepare a series of dilutions to generate a standard curve for quantitative analysis.
Detection System: Implement a detection system using primary antibodies specific to VN1R5 or the tag, followed by enzyme-conjugated secondary antibodies.
Signal Development: Develop using an appropriate substrate and read at the wavelength corresponding to the detection system employed.
The assay should include positive and negative controls, and validation may be necessary to confirm specificity when working with primate vomeronasal receptors due to potential cross-reactivity .
To study VN1R5 expression in tissue samples, researchers may employ several complementary techniques:
RT-PCR and qPCR: Design primers specific to gorilla VN1R5 mRNA to detect and quantify gene expression. This method is particularly useful for comparing expression levels across different tissue types or conditions.
In Situ Hybridization (ISH): Develop RNA probes complementary to VN1R5 transcripts to visualize expression patterns within tissue sections, providing spatial information about receptor expression.
Immunohistochemistry (IHC): Utilize antibodies against VN1R5 to detect protein expression in fixed tissue sections. This approach reveals cellular and subcellular localization of the receptor.
Western Blotting: Extract proteins from tissues and perform immunoblotting using VN1R5-specific antibodies to quantify protein expression levels.
RNAseq Analysis: Conduct transcriptome sequencing to measure VN1R5 expression within the context of the global gene expression profile.
When interpreting results, it's important to note that vomeronasal receptor genes often show clustered genomic organization, which can affect their expression patterns .
The genomic organization of vomeronasal receptor genes, including VN1R5, plays a crucial role in their transcriptional regulation. Research indicates that functional vomeronasal receptor genes typically exist in clusters within mammalian genomes, while pseudogenes are often scattered throughout the genome. This clustering appears to be evolutionarily conserved due to selective pressure on transcriptional maintenance rather than receptor choice specificity.
Studies have shown that vomeronasal receptor genes located within functional clusters are more likely to maintain stable transcription compared to isolated genes. This suggests the presence of cluster-associated regulatory elements that stabilize gene expression. These elements are not directly coupled to individual receptor gene units but rather operate at the cluster level, potentially affecting multiple genes within the same cluster.
This genomic arrangement has significant implications for experimental design when studying VN1R5 expression, as the receptor's genomic context may influence its transcriptional behavior. Researchers should consider both the intrinsic promoter elements of VN1R5 and the broader regulatory landscape of its genomic cluster when investigating expression patterns .
Recent studies have identified VN1R5 as a cisplatin resistance-related protein in head and neck squamous cell carcinoma (HNSCC). The mechanism involves VN1R5's ability to transcriptionally regulate the long non-coding RNA lnc-POP1-1 via activation of the specificity protein 1 (Sp1) transcription factor through the cyclic AMP (cAMP)/protein kinase A (PKA) pathway.
The downstream effects of this regulatory pathway include:
Upregulation of lnc-POP1-1 in cisplatin-resistant HNSCC cells
Direct binding of lnc-POP1-1 to minichromosome maintenance deficient 5 (MCM5) protein
Inhibition of MCM5 protein ubiquitination, thereby reducing its degradation
Enhanced repair of cisplatin-induced DNA damage
This signaling cascade represents a novel mechanism of chemoresistance that may be targeted therapeutically. Researchers investigating cancer drug resistance may consider VN1R5 as a potential biomarker or therapeutic target, particularly in HNSCC and potentially other malignancies where cisplatin resistance poses a clinical challenge .
To investigate signaling pathways downstream of VN1R5 activation, researchers can employ the following methodological approaches:
cAMP Assays: Since VN1R5 has been shown to activate the cAMP/PKA pathway, researchers can measure intracellular cAMP levels using ELISA-based or FRET-based assays following receptor stimulation with potential ligands.
Calcium Imaging: Monitor intracellular calcium flux using fluorescent calcium indicators to assess VN1R5-mediated signaling, as many G-protein coupled receptors activate calcium-dependent pathways.
Phosphorylation Analysis: Employ phospho-specific antibodies in Western blotting or mass spectrometry approaches to identify proteins phosphorylated following VN1R5 activation, particularly focusing on PKA substrates.
Transcription Factor Activity Assays: Assess the activity of transcription factors like Sp1 using reporter gene assays, chromatin immunoprecipitation (ChIP), or electrophoretic mobility shift assays (EMSA).
RNA-Seq and Pathway Analysis: Perform transcriptome analysis following VN1R5 activation or knockdown to identify regulated genes and infer activated signaling networks.
Protein-Protein Interaction Studies: Use co-immunoprecipitation, proximity ligation assays, or FRET-based approaches to identify proteins interacting with VN1R5 in the signaling cascade.
When designing these experiments, it's important to consider appropriate cell models that express the necessary signaling components and to include positive and negative controls to validate the specificity of VN1R5-mediated signaling .
Comparative analysis of VN1R5 across primate species reveals evolutionary patterns that may inform functional studies. While the search results don't provide direct comparisons between gorilla VN1R5 and other primates, the general patterns observed in vomeronasal receptor evolution suggest:
Sequence Conservation and Divergence: VN1R5 likely shows regions of high conservation in functional domains critical for signal transduction, while ligand-binding regions may exhibit greater divergence, reflecting species-specific adaptations.
Pseudogenization Patterns: Many vomeronasal receptor genes have become pseudogenes during primate evolution. Comparative analysis could reveal whether VN1R5 maintains functionality across different primate lineages or has undergone pseudogenization in some species.
Genomic Context: The clustering pattern of VN1R5 and its proximity to other vomeronasal receptor genes may vary across primates, potentially affecting its regulation and expression.
To study these evolutionary aspects, researchers should employ phylogenetic analysis of VN1R5 sequences, genomic synteny analysis to examine conservation of gene clusters, and functional assays to compare signaling properties of orthologous receptors .
To investigate functional differences between VN1R5 and other vomeronasal receptors, researchers can implement these methodological approaches:
Heterologous Expression Systems: Express gorilla VN1R5 and other vomeronasal receptors in cell lines such as HEK293 or HeLa cells to compare their signaling properties in a controlled environment.
Ligand Screening: Develop high-throughput screening assays to identify and compare ligand specificities of different vomeronasal receptors, using fluorescence-based or bioluminescence-based reporter systems.
Structural Modeling and Docking: Generate homology models of VN1R5 and other vomeronasal receptors to predict ligand-binding sites and conduct in silico docking studies to compare binding affinities.
Chimeric Receptor Analysis: Create chimeric receptors by swapping domains between VN1R5 and other vomeronasal receptors to identify regions responsible for functional differences.
CRISPR-Cas9 Gene Editing: In appropriate cell or animal models, use gene editing to introduce specific mutations or domain swaps to test functional hypotheses derived from comparative analysis.
These approaches can help elucidate the specific functional adaptations of VN1R5 compared to other members of the vomeronasal receptor family .
Working with recombinant vomeronasal receptors like VN1R5 presents several technical challenges:
Protein Solubility and Stability:
Challenge: Vomeronasal receptors are membrane proteins with hydrophobic domains, making them difficult to solubilize while maintaining native conformation.
Solution: Use specialized detergents or lipid nanodisc technology to mimic the membrane environment. The glycerol content (50%) in the storage buffer for recombinant VN1R5 helps maintain stability .
Expression Systems:
Challenge: Achieving functional expression of mammalian vomeronasal receptors in heterologous systems.
Solution: Optimize codon usage for expression host, use inducible expression systems, and consider co-expression with appropriate G proteins or chaperones.
Ligand Identification:
Challenge: Natural ligands for many vomeronasal receptors remain unknown or difficult to source.
Solution: Implement unbiased screening approaches using chemical libraries or biological extracts, followed by structural verification of hits.
Functional Assays:
Challenge: Establishing reliable readouts for receptor activation.
Solution: Develop multiple complementary assays (cAMP, calcium flux, β-arrestin recruitment) to confirm receptor functionality.
Antibody Specificity:
Challenge: Limited availability of specific antibodies for vomeronasal receptors.
Solution: Validate antibodies thoroughly using positive and negative controls, and consider epitope tagging of recombinant receptors.
When studying VN1R5 transcriptional regulation, researchers should consider these methodological optimizations:
Genomic Context Preservation:
Approach: Use bacterial artificial chromosomes (BACs) or other large-insert cloning systems that maintain the native genomic context when studying VN1R5 expression.
Rationale: As demonstrated in the literature, vomeronasal receptor gene clustering plays a crucial role in transcriptional maintenance .
Cell Type Selection:
Approach: When possible, use cell types derived from vomeronasal tissue or engineer cells to express the necessary transcriptional machinery.
Rationale: Vomeronasal receptors have specialized transcriptional requirements that may not be fulfilled in standard cell lines.
Temporal Considerations:
Methodology Integration:
Approach: Combine chromatin analysis (ChIP-seq, ATAC-seq) with transcriptional profiling (RNA-seq, qPCR) and reporter assays.
Rationale: This multi-faceted approach can reveal both the mechanisms and outcomes of transcriptional regulation.
Control Selection:
Approach: Include both clustered and isolated vomeronasal receptor genes as comparators when studying VN1R5 expression.
Rationale: This contrast can highlight the influence of genomic context on expression patterns.
By implementing these optimized approaches, researchers can more effectively investigate the complex transcriptional regulation of VN1R5 and generate more reliable and interpretable results.