Recombinant Gossypium barbadense Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Gossypium barbadense (Sea-island cotton) (Egyptian cotton)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPTKKNILVIGPVPG KKYSEITFPILSPDPASNKDAHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATATGIIS KIIRKEKGGYEITITDALDGHQVVDIIPPGPELLVSEGESIKLDQPLTINPNVGGFGQGD AEIVLQDPLRVQGLLFFLASIVFAQIFLVLKKKQFEKVQVSEMNF
Uniprot No.

Target Background

Function
Recombinant Gossypium barbadense Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Gossypium barbadense Apocytochrome f and its role in photosynthetic processes?

Apocytochrome f, encoded by the petA gene in Gossypium barbadense (Sea-island cotton/Egyptian cotton), is a crucial component of the photosynthetic electron transport chain. The protein functions as part of the cytochrome b6f complex, facilitating electron transfer between photosystem II and photosystem I. This process is essential for energy conversion during photosynthesis in cotton plants . The mature protein contains characteristic heme-binding domains and transmembrane regions that anchor it to the thylakoid membrane.

The amino acid sequence (YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPTKKNILVIGPVPGKKYSEITFPILSPDPASNKDAHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATATGIISKIIRKEKGGYEITITDALDGHQVVDIIPPGPELLVSEGESIKLDQPLTINPNVGGFGQGDAEIVLQDPLRVQGLLFFLASIVFAQIFLVLKKKQFEKVQVSEMNF) reveals conserved domains essential for electron transport functionality .

How does Gossypium barbadense petA gene organization compare to other plant species?

The petA gene expression in G. barbadense is regulated by nuclear-encoded factors, similar to what has been observed in Arabidopsis mutants with altered expression of chloroplast petA gene . Comparative studies reveal that the coding sequence is highly conserved across species, while regulatory elements show more variation, reflecting evolutionary adaptations to different environmental conditions.

What are the optimal storage and handling conditions for recombinant Gossypium barbadense Apocytochrome f?

For optimal preservation of recombinant G. barbadense Apocytochrome f, the protein should be stored in a Tris-based buffer with 50% glycerol at -20°C. For extended storage periods, conservation at -80°C is recommended to maintain protein integrity and functionality .

When working with the protein:

  • Avoid repeated freeze-thaw cycles as they significantly compromise protein stability and activity

  • Store working aliquots at 4°C for no longer than one week

  • When preparing aliquots, use sterile techniques to prevent contamination

  • Allow the protein to equilibrate to room temperature before opening containers to prevent condensation

How can researchers effectively use recombinant Apocytochrome f in photosynthetic electron transport studies?

Methodological approach for investigating photosynthetic electron transport using recombinant Apocytochrome f:

  • Functional reconstitution: Incorporate the recombinant protein into liposomes or artificial membrane systems to study electron transfer kinetics.

  • Analytical techniques:

    • Spectroscopic analysis (absorption and fluorescence) to monitor redox changes

    • Electrochemical measurements to quantify electron transfer rates

    • Stopped-flow kinetics to determine reaction mechanisms

  • Integration with other components: Combine with purified photosystem I and II components to reconstruct partial or complete electron transport chains.

  • Mutational analysis: Compare wild-type protein function with site-directed mutants to identify critical residues for electron transport, using techniques similar to those employed in Arabidopsis thaliana studies .

  • Environmental response studies: Assess protein function under varying light conditions, similar to photosynthetic acclimation studies in fluctuating light environments .

How can transcriptome analysis illuminate the relationship between petA expression and fiber development in Gossypium barbadense?

Transcriptome analysis provides powerful insights into the temporal expression patterns of petA and its relationship to fiber development in G. barbadense. Researchers can implement the following methodological approach:

  • RNA-seq experimental design: Extract RNA from fiber tissues at multiple developmental stages (0-35 days postanthesis), as demonstrated in recent G. barbadense studies .

  • Differential expression analysis: Identify developmental stage-specific expression patterns of petA and co-expressed genes during fiber development.

  • Weighted gene coexpression network analysis (WGCNA): This technique identifies gene modules with coordinated expression patterns that correlate with fiber development stages, particularly the secondary wall-thickening phase critical for fiber strength .

  • Integration with quantitative trait loci (QTL) data: Combine transcriptome data with QTL mapping to identify potential regulatory relationships between petA expression and fiber quality traits. This approach has successfully identified genes involved in fiber strength regulation in G. barbadense .

  • Validation: Confirm transcriptome findings using quantitative real-time PCR to verify expression patterns of petA and associated genes .

The coordination between chloroplast function (including petA expression) and fiber development may reveal unexpected connections between photosynthetic capacity and fiber quality traits.

What are the implications of genome duplication events on petA evolution in allotetraploid Gossypium barbadense?

The evolutionary trajectory of petA in G. barbadense has been shaped by significant genome duplication events:

  • Allopolyploidization effects: As an allotetraploid cotton species formed approximately 1-2 million years ago (Mya), G. barbadense contains subgenomes derived from A-genome and D-genome ancestors . This genome merger has influenced petA gene evolution through:

    • Subgenome interactions

    • Expression bias between homeologous copies

    • Selective pressures on redundant gene copies

  • Ancient whole-genome duplication (WGD): G. barbadense exhibits evidence of WGD events occurring 50-70 Mya, which expanded gene families and created opportunities for subfunctionalization and neofunctionalization of genes, potentially including petA .

  • Pseudogenization: Accelerated pseudogenization occurred after allopolyploid formation, with G. barbadense containing more predicted pseudogenes than its diploid relatives . This process may have influenced the fate of duplicated photosynthetic genes.

  • Selection analysis methodology: Calculate Ka/Ks ratios (the ratio of nonsynonymous to synonymous substitutions) to assess selection pressure on petA copies. The distributions indicate substantially weaker natural selection on pseudogenes compared to functional protein-coding genes .

These evolutionary processes provide context for understanding the current state and function of petA in G. barbadense's photosynthetic apparatus.

What experimental challenges commonly arise when working with recombinant Apocytochrome f, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Apocytochrome f:

  • Protein solubility issues:

    • Challenge: Apocytochrome f contains hydrophobic regions that can lead to aggregation.

    • Solution: Optimize buffer conditions with appropriate detergents or lipid environments. The Tris-based buffer with 50% glycerol used for storage provides a starting point for experimental optimizations .

  • Maintaining protein activity:

    • Challenge: Loss of functionality during purification or storage.

    • Solution: Minimize freeze-thaw cycles and maintain samples at 4°C for short-term use. For activity assays, include appropriate cofactors and maintain reducing conditions to preserve native protein conformation .

  • Expression system compatibility:

    • Challenge: Expressing plant chloroplast proteins in heterologous systems.

    • Solution: Select expression systems with appropriate post-translational modification capabilities. The tag type should be determined during the production process based on protein characteristics and experimental requirements .

  • Specificity in functional assays:

    • Challenge: Distinguishing specific petA activity from background reactions.

    • Solution: Include appropriate controls and use purified components when reconstructing electron transport chains in vitro.

How can researchers effectively integrate G. barbadense petA studies with broader plant photosynthesis research?

Methodological framework for integrating G. barbadense petA research with broader plant photosynthesis studies:

  • Comparative genomics approach:

    • Align petA sequences across plant species to identify conserved and divergent regions

    • Compare expression patterns in different photosynthetic tissues

    • Analyze regulatory elements controlling petA expression across species

  • Functional complementation studies:

    • Express G. barbadense petA in model organisms with petA mutations

    • Assess restoration of photosynthetic function using chlorophyll fluorescence and growth measurements

    • Identify species-specific functional differences

  • Environmental response profiling:

    • Compare petA expression and protein function under various stress conditions across species

    • Connect findings to adaptation mechanisms in different plant lineages

    • Use approaches similar to those employed in Arabidopsis studies on photosynthetic acclimation to fluctuating light environments

  • Integration with systems biology:

    • Map petA into photosynthetic protein interaction networks

    • Identify species-specific differences in network architecture

    • Connect findings with fiber development pathways unique to cotton species

How might CRISPR-Cas9 technology be applied to study petA function in Gossypium barbadense?

CRISPR-Cas9 genome editing offers powerful approaches for investigating petA function in G. barbadense:

  • Targeted modification strategies:

    • Generate specific mutations in conserved domains to assess functional consequences

    • Create regulatory element modifications to alter expression patterns

    • Introduce reporter gene fusions to monitor expression dynamics in vivo

  • Methodological workflow:

    • Design guide RNAs targeting specific petA regions

    • Optimize transformation protocols for G. barbadense tissues

    • Screen transformants using high-resolution melting analysis or sequencing

    • Characterize phenotypic effects through photosynthetic parameter measurements

  • Integration with fiber development research:

    • Create conditional petA mutations activated during specific fiber development stages

    • Assess impacts on fiber elongation and secondary wall thickening

    • Connect findings with QTLs associated with fiber strength

  • Potential limitations and considerations:

    • Transformation efficiency in G. barbadense

    • Potential off-target effects

    • Phenotypic characterization challenges in allotetraploid backgrounds

What synergies exist between petA research and emerging transcriptomics approaches for improving cotton fiber quality?

The integration of petA research with advanced transcriptomics offers promising avenues for cotton improvement:

  • Multi-omics integration methodology:

    • Combine transcriptome, proteome, and metabolome analyses across fiber development stages

    • Map photosynthetic gene networks (including petA) onto fiber development pathways

    • Identify regulatory hubs connecting energy metabolism with fiber quality traits

  • Weighted gene coexpression network analysis applications:

    • Identify modules containing petA and fiber-related genes

    • Focus on secondary wall-thickening stages critical for fiber strength development

    • Apply approaches similar to those used in recent G. barbadense transcriptome studies

  • Potential targets for functional validation:

    • Genes co-expressed with petA during critical fiber development windows

    • Transcription factors potentially regulating both photosynthetic and fiber development genes

    • Factors like Gbar_D11G032910, Gbar_D08G020540, or others identified in fiber strength QTL regions

  • Expected outcomes:

    • New understanding of energy allocation during fiber development

    • Identification of photosynthetic efficiency factors that indirectly influence fiber quality

    • Development of biomarkers for early selection of superior fiber quality traits

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.