Recombinant Gossypium barbadense ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can serve as a reference point for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. Lyophilized forms maintain a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is defined during production. If you have specific tag preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Gossypium barbadense (Sea-island cotton) (Egyptian cotton)
Target Names
atpI
Target Protein Sequence
MNGISNALNGLYDISGVEVGQHFYWQIAGFQVHAQVLITSWVVIAILLGSAVIAVRNPQT IPTAGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKIIQLP HGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILEDFTKP LSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFISGIQALIFATLAAAYIGESM EGHH
Uniprot No.

Target Background

Function
This protein serves as a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a (atpI) in cotton chloroplasts?

The atpI gene in cotton chloroplasts encodes subunit IV of the CFo component of ATP synthase. This protein forms part of the membrane-embedded portion that facilitates proton transport across the thylakoid membrane. The complete chloroplast ATP synthase consists of two main components: CF1 (the catalytic portion) and CFo (the membrane-embedded portion). Within the CFo component, subunits I (atpF), III (atpH), and IV (atpI) are encoded by chloroplast genes and form the proton channel . The atpI subunit specifically contributes to the stability of the ATP synthase complex and is crucial for proper proton translocation, ultimately affecting ATP production.

Structurally, chloroplast ATP synthase consists of multiple subunits that form two major components:

ComponentSubunitsEncoding GenomeFunction
CF1α (atpA), β (atpB), γ (atpC), δ (atpD), ε (atpE)Chloroplast (α, β, ε), Nuclear (γ, δ)Catalytic portion for ATP synthesis
CFoI (atpF), II (atpG), III (atpH), IV (atpI)Chloroplast (I, III, IV), Nuclear (II)Proton channel in membrane

In Gossypium species, the chloroplast genes encoding ATP synthase subunits are organized in two gene clusters that are co-transcribed, with atpI being essential for maintaining proper CFo assembly and function .

What methods are recommended for expressing recombinant G. barbadense atpI protein?

Expression of recombinant atpI from G. barbadense requires specialized approaches due to its hydrophobic nature as a membrane protein. A recommended methodology includes:

  • Gene isolation: Extract total DNA from young G. barbadense leaves and amplify the atpI gene using PCR with primers designed based on conserved regions in Gossypium species.

  • Expression vector selection: Choose vectors with strong inducible promoters (T7, tac) and fusion tags that enhance solubility (MBP, SUMO) or facilitate purification (His, GST).

  • Expression system optimization: Test multiple expression systems including:

    • E. coli strains specialized for membrane proteins (C41/C43)

    • Cell-free expression systems that accommodate membrane proteins

    • Yeast or insect cell systems for eukaryotic post-translational processing

  • Expression conditions: Use lower temperatures (16-20°C) and reduced inducer concentrations to prevent inclusion body formation. For E. coli systems, supplement with rare codons and consider co-expression with chaperones.

  • Membrane extraction: Use specialized detergents (DDM, LMNG) to solubilize the membrane fraction containing the expressed protein.

This approach addresses the challenges in expressing membrane proteins while maintaining their structural integrity, similar to methods used for other ATP synthase subunits in related research .

How does the atpI gene contribute to ROS metabolism in cotton species?

Research on cotton species has demonstrated that ATP synthase subunits, including atpI, play significant roles in reactive oxygen species (ROS) metabolism. The atpI subunit contributes to ROS metabolism through several mechanisms:

  • Energy balance regulation: Proper functioning of atpI ensures efficient ATP production, which powers ROS-scavenging systems in the chloroplast. When ATP synthase activity is compromised due to mutations or altered expression of atpI, energy imbalance occurs, leading to electron leakage from photosystems and increased ROS production .

  • Proton gradient maintenance: As part of the proton channel in CFo, atpI helps maintain the proton gradient across the thylakoid membrane. Disruption of this gradient affects electron transport chain efficiency, potentially leading to ROS accumulation .

  • Interaction with photosystem function: Studies in cotton have shown that decreased expression of ATP synthase genes, including atpI, can impede chloroplast-related reactions, resulting in ROS accumulation, particularly H2O2 and singlet oxygen .

Experimental evidence from Jin A cytoplasmic male sterility (CMS) lines shows that abnormal programmed cell death in tapetal cells is induced by excessive ROS accumulation, which correlates with decreased expression of ATP synthase genes. The altered ATP synthesis capacity affects cellular energy homeostasis, making plants more susceptible to oxidative stress .

What factors should be considered when designing purification protocols for recombinant atpI?

Purifying recombinant atpI requires careful consideration of several factors due to its membrane protein nature:

  • Detergent selection: Choose detergents appropriate for membrane proteins, with consideration for:

    • Critical micelle concentration (CMC)

    • Micelle size

    • Compatibility with downstream applications

    • Commonly effective options include DDM, LMNG, or digitonin for ATP synthase components

  • Buffer optimization:

    • pH: Typically 7.0-8.0 for most chloroplast proteins

    • Ionic strength: 150-300 mM salt to maintain protein stability

    • Glycerol (10-20%): To enhance protein stability

    • Reducing agents: To prevent oxidation of cysteine residues

  • Purification strategy:

    • Initial capture: Affinity chromatography using fusion tags (His, GST)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography in the presence of appropriate detergents

  • Quality assessment methods:

    • SDS-PAGE and western blotting

    • Mass spectrometry for identity confirmation

    • Circular dichroism to assess secondary structure integrity

    • Dynamic light scattering to assess aggregation state

  • Storage considerations:

    • Temperature: Typically -80°C for long-term storage

    • Additives: Glycerol, specific lipids, or amphipols for stability

    • Aliquoting to avoid freeze-thaw cycles

These approaches are based on successful protocols used for other membrane proteins of similar complexity in structural studies .

How can functional assays be designed to assess recombinant atpI activity?

Assessing the functional activity of recombinant atpI requires specialized approaches that consider its role within the ATP synthase complex:

  • Reconstitution systems:

    • Liposome reconstitution: Incorporate purified atpI into lipid vesicles with defined composition

    • Co-reconstitution with partner subunits (atpF, atpH) to form functional CFo

    • Complete ATP synthase reconstitution when studying integrated function

  • Proton translocation assays:

    • pH-sensitive fluorescent probes (ACMA, pyranine) to monitor proton movement

    • Measurement of pH changes in reconstituted systems under varying conditions

    • Assessment of the effect of inhibitors on proton translocation efficiency

  • Assembly assessment:

    • Blue native PAGE to analyze complex formation

    • Co-immunoprecipitation with other ATP synthase subunits

    • Cross-linking studies to evaluate protein-protein interactions

  • Complementation studies:

    • Expression in bacterial or yeast ATP synthase-deficient mutants

    • Assessment of growth rescue under ATP-limiting conditions

    • Measurement of ATP synthesis in complemented systems

  • Biophysical characterization:

    • Circular dichroism to assess structural integrity

    • Thermal stability assays to determine protein stability

    • Limited proteolysis to evaluate folding quality

These methodologies provide comprehensive assessment of atpI functionality, similar to approaches used for other membrane protein components of energy-generating systems .

How do mutations in atpI impact cotton male fertility through ROS regulation?

Mutations in the atpI gene can significantly impact male fertility in cotton through altered ROS metabolism. Research methodologies for investigating this relationship include:

  • Comparative genomics approach:

    • Sequence analysis of atpI between fertile and sterile (CMS) cotton lines

    • Identification of polymorphisms specific to male-sterile phenotypes

    • Structural modeling to predict functional impacts of mutations

  • Expression profiling:

    • RT-qPCR analysis of atpI expression during anther development

    • Comparison between fertile and sterile lines at critical developmental stages

    • Correlation with expression of ROS-related genes

  • Functional analysis:

    • RNAi or CRISPR-based modification of atpI in fertile lines

    • Overexpression of wild-type or mutant atpI in sterile backgrounds

    • Phenotypic assessment of resulting plants, focusing on pollen development

  • ROS characterization:

    • Fluorescent probe-based measurement of H2O2 and singlet oxygen in anthers

    • Histochemical staining (DAB, NBT) for tissue-specific ROS localization

    • Enzymatic assays for ROS-scavenging activities (SOD, CAT, APX)

Research in cotton CMS lines has demonstrated that ATP synthase dysfunction leads to premature programmed cell death in tapetal cells due to excessive ROS accumulation. The ATP content decreases significantly at the microspore abortion stage in CMS lines, and chloroplast enzymes and genes related to ROS clearance show differential expression compared to maintainer lines .

What structural features of atpI are critical for interaction with other ATP synthase subunits?

Understanding the structural determinants of atpI interactions requires detailed analysis:

  • Sequence conservation analysis:

    • Multiple sequence alignment of atpI across Gossypium species

    • Identification of highly conserved residues at potential interaction interfaces

    • Evolutionary rate analysis to identify functionally constrained regions

  • Protein-protein interaction mapping:

    • Yeast two-hybrid or split-GFP assays to identify interacting partners

    • Co-immunoprecipitation followed by mass spectrometry

    • Surface plasmon resonance to measure binding affinities

  • Structural analysis techniques:

    • Cryo-EM of reconstituted complexes containing atpI

    • Cross-linking mass spectrometry to identify contact points

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Mutagenesis studies:

    • Alanine scanning of conserved residues

    • Charge reversal mutations at potential salt bridges

    • Domain swapping with homologs from other species

Critical structural features likely include transmembrane helices that interact with other CFo subunits, particularly atpF and atpH, to form the proton channel. Additionally, regions that interact with the CF1 domain are important for maintaining proper orientation and assembly of the complete ATP synthase complex .

How does the integration of nuclear and chloroplast-encoded ATP synthase subunits affect energy homeostasis?

The integration of nuclear and chloroplast-encoded ATP synthase subunits represents a complex intergenomic coordination crucial for energy homeostasis:

  • Coordination assessment methodologies:

    • Transcriptome analysis of nuclear and chloroplast gene expression under various conditions

    • Proteomics to quantify stoichiometry of assembled complexes

    • Pulse-chase labeling to determine turnover rates of different subunits

  • Signaling pathway investigation:

    • Analysis of retrograde signaling from chloroplast to nucleus

    • Identification of transcription factors regulating nuclear-encoded subunits

    • Characterization of post-transcriptional regulation mechanisms

  • Functional consequences measurement:

    • ATP/ADP ratio monitoring in plants with altered subunit expression

    • Electron transport chain efficiency assessment

    • Measurement of proton motive force across thylakoid membranes

  • Interspecific hybridization studies:

    • Creation of cybrid plants with nuclear genome from one species and chloroplast from another

    • Analysis of compatibility between nuclear and chloroplast-encoded subunits

    • Assessment of energy production efficiency in hybrid systems

Research in other plant systems has shown that proper coordination between nuclear and chloroplast gene expression is essential for maintaining optimal ATP synthase assembly and function. Disruption of this coordination can lead to reduced energy production efficiency, altered ROS metabolism, and impaired plant development .

What techniques can optimize structural studies of recombinant G. barbadense ATP synthase?

Advanced structural biology approaches for G. barbadense ATP synthase include:

  • Protein production optimization:

    • Cell-free expression systems for difficult membrane proteins

    • Nanodiscs or amphipol incorporation for membrane protein stabilization

    • Co-expression of multiple subunits for proper complex assembly

  • Cryo-electron microscopy approaches:

    • Sample vitrification optimization (blotting time, humidity)

    • Grid selection (holey carbon, graphene oxide-coated)

    • Data collection parameters (dose, frame rate, pixel size)

    • Image processing workflows for heterogeneous samples

  • Complementary structural techniques:

    • Hydrogen-deuterium exchange mass spectrometry for dynamics information

    • Cross-linking mass spectrometry for interface identification

    • Small-angle X-ray scattering for solution structure

    • Solid-state NMR for specific domain interactions

  • Computational methods:

    • Molecular dynamics simulations of the assembled complex

    • Homology modeling based on related structures

    • AlphaFold2 or RoseTTAFold predictions integrated with experimental data

Recent advances in cryo-EM have revolutionized membrane protein structural biology, allowing visualization of ATP synthase at near-atomic resolution. These techniques have revealed critical elements for ATP synthesis and hydrolysis in other systems, providing templates for similar studies in cotton ATP synthase .

How can recombinant atpI be used to develop cotton lines with enhanced stress tolerance?

Utilizing recombinant atpI for developing stress-tolerant cotton involves multiple integrated approaches:

  • Phenotypic screening methodology:

    • Expression profiling of atpI under various stress conditions

    • Identification of natural variants with enhanced stress performance

    • Correlation of sequence polymorphisms with stress tolerance traits

  • Genetic engineering strategies:

    • Overexpression of wild-type or enhanced atpI variants

    • Site-directed mutagenesis of key residues affecting stability or activity

    • Promoter modifications for stress-responsive expression

  • Physiological assessment parameters:

    • Photosynthetic efficiency under stress conditions

    • ROS production and scavenging capacity

    • Energy status (ATP/ADP ratio) monitoring

    • Stress-related metabolite profiling

  • Field validation approaches:

    • Controlled stress trials of transgenic lines

    • Multi-location testing under diverse environmental conditions

    • Yield component analysis under stress vs. normal conditions

Research has shown that ATP synthase function is closely linked to stress tolerance in plants, with optimal ATP synthase activity helping maintain energy homeostasis during stress. Variations in atpI that enhance stability or activity of the ATP synthase complex could potentially improve plant performance under adverse conditions by maintaining ATP production and reducing stress-induced ROS accumulation .

What are the best practices for experimental design when studying atpI function in different cotton tissues?

Robust experimental design for tissue-specific atpI function studies should include:

  • Tissue sampling strategy:

    • Collection at defined developmental stages

    • Precise microdissection techniques for specific tissues

    • Immediate preservation methods to prevent degradation

  • Expression analysis workflow:

    • RT-qPCR with tissue-specific reference genes

    • RNA-seq for global expression patterns

    • Protein extraction protocols optimized for different tissues

    • Immunolocalization for spatial distribution patterns

  • Tissue-specific functional assessment:

    • Chloroplast isolation from different tissues

    • ATP synthase activity measurements in isolated organelles

    • ROS levels quantification in specific tissues

    • Energy status determination (ATP/ADP, NAD(P)H/NAD(P)+)

  • Statistical design considerations:

    • Minimum of 3-5 biological replicates

    • Power analysis to determine sample size requirements

    • Appropriate controls (positive, negative, wild-type)

    • Blind analysis to prevent bias

  • Data integration approaches:

    • Multi-omics data correlation

    • Network analysis for tissue-specific pathways

    • Machine learning for pattern identification

Studies in cotton have shown tissue-specific patterns of ATP synthase gene expression, with reproductive tissues being particularly sensitive to alterations in ATP synthase function, as evidenced in CMS lines where anther development is severely affected by ATP synthase dysfunction .

How can contradictions in atpI research data be resolved through improved experimental approaches?

Resolving contradictions in atpI research requires systematic methodological improvements:

  • Standardization of experimental systems:

    • Consistent plant growth conditions (light, temperature, nutrients)

    • Standardized genetic backgrounds for comparative studies

    • Unified protocols for protein expression and purification

    • Reference standards for activity measurements

  • Methodological triangulation:

    • Multiple complementary techniques to address the same question

    • Independent validation in different laboratories

    • Various experimental systems (in vitro, in vivo, in silico)

    • Cross-species confirmation of findings

  • Comprehensive controls implementation:

    • Positive and negative controls for each experiment

    • Dose-response relationships rather than single-point measurements

    • Time-course studies instead of single time points

    • Wild-type comparisons alongside mutant analysis

  • Advanced statistical approaches:

    • Meta-analysis of published data

    • Bayesian methods for hypothesis testing

    • Multiple testing correction in high-throughput studies

    • Effect size calculation beyond p-value reporting

  • Open science practices:

    • Complete methodology reporting

    • Raw data sharing

    • Null result publication

    • Rigorous peer review process

For example, contradictory findings regarding the role of ATP synthase in ROS metabolism can be addressed by standardizing ROS measurement techniques, ensuring proper controls for ATP synthase activity measurements, and considering the genetic background and environmental conditions of the experimental systems .

What novel technologies can advance our understanding of atpI regulation in G. barbadense?

Cutting-edge technologies that can revolutionize atpI research include:

  • Single-molecule techniques:

    • FRET-based approaches to monitor conformational changes

    • Optical tweezers to study mechanical properties

    • Single-molecule tracking in living cells

    • Patch-clamp of reconstituted ATP synthase

  • Advanced imaging technologies:

    • Super-resolution microscopy (STORM, PALM) for spatial organization

    • Correlative light and electron microscopy

    • Cryo-electron tomography of organelles

    • Label-free imaging techniques

  • Genome editing advances:

    • Base editing for precise nucleotide changes

    • Prime editing for targeted modifications

    • Inducible CRISPR systems for temporal control

    • Chloroplast genome editing technologies

  • Systems biology approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • Network modeling of ATP synthase interactions

    • Machine learning for pattern recognition in complex datasets

    • Constraint-based modeling of energy metabolism

  • Synthetic biology strategies:

    • Minimal ATP synthase design

    • Orthogonal expression systems

    • Designer ATP synthase variants with enhanced properties

    • In vitro reconstitution of synthetic systems

These technologies can provide unprecedented insights into how atpI is regulated at multiple levels, from transcription and translation to post-translational modifications and protein-protein interactions, ultimately revealing how ATP synthase function is integrated with cellular metabolism and environmental responses .

How should environmental variables be controlled when studying atpI function in stress response?

Rigorous environmental control is essential for reproducible stress response studies:

  • Growth condition standardization:

    • Controlled environment chambers with precise parameters

    • Defined soil/media composition with batch consistency

    • Regular monitoring of environmental variables

    • Randomized positioning to account for microenvironment variations

  • Stress application protocols:

    • Gradual vs. shock stress imposition

    • Precisely defined stress parameters (e.g., water potential, salt concentration)

    • Monitoring of actual stress experienced by plant tissues

    • Recovery phases standardization

  • Temporal considerations:

    • Developmental stage synchronization

    • Time-course sampling with consistent intervals

    • Diurnal cycle standardization

    • Duration of stress application consistency

  • Multifactorial design implementation:

    • Combined stress treatments reflecting natural conditions

    • Interaction analysis between different stressors

    • Gradient of stress intensity rather than single level

    • Factorial designs to determine main effects and interactions

  • Physiological status verification:

    • Standard stress markers measurement (proline, MDA)

    • Water status parameters (RWC, water potential)

    • Photosynthetic efficiency (Fv/Fm, ETR)

    • Growth parameters documentation

Research on ATP synthase function under stress has shown that experimental outcomes can vary significantly depending on the nature, intensity, and duration of stress application, making standardized protocols essential for meaningful comparisons across studies .

What are the optimal approaches for translating basic atpI research into applied cotton breeding programs?

Effective translation of atpI research into breeding applications requires:

  • Germplasm screening methodology:

    • High-throughput DNA isolation and sequencing

    • Targeted resequencing of atpI and related genes

    • Haplotype analysis across diverse cotton germplasm

    • Association of sequence variants with phenotypic traits

  • Marker development strategy:

    • SNP identification in atpI and regulatory regions

    • KASP or TaqMan assay development for breeding applications

    • Validation across diverse genetic backgrounds

    • Correlation with phenotypic performance

  • Trait integration approaches:

    • QTL mapping of energy efficiency-related traits

    • Genomic selection models incorporating ATP synthase genes

    • Multi-trait selection indices including stress tolerance

    • Ideotype design based on optimal ATP synthase function

  • Validation pipeline:

    • Controlled environment phenotyping

    • Field evaluations under multiple environments

    • Yield and fiber quality assessment

    • Stress tolerance verification under realistic conditions

  • Technology transfer mechanisms:

    • Breeder-friendly tools and protocols

    • Training programs for marker-assisted selection

    • Open-access databases of genetic variation

    • Collaborative networks between researchers and breeders

The close relationship between ATP synthase function, energy homeostasis, and stress tolerance makes atpI an attractive target for breeding programs aimed at developing cotton varieties with improved performance under suboptimal conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.