Recombinant Gossypium barbadense Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplast Biology

cemA is implicated in two critical processes:

Transport Across the Chloroplast Envelope

Proteomic studies identify cemA as a hydrophobic membrane protein with multiple predicted transmembrane (TM) domains, suggesting a role in metabolite transport . In Arabidopsis, similar envelope proteins facilitate the exchange of ions, amino acids, and cofactors between chloroplasts and the cytosol . While cemA’s specific substrates remain uncharacterized, its structural similarity to known transporters supports this function.

Reactive Oxygen Species (ROS) Metabolism

cemA is linked to chloroplast ATP synthase and ROS regulation in studies of cytoplasmic male sterility (CMS) in Gossypium . Transcriptomic and proteomic analyses reveal differential expression of cemA during microspore abortion stages, correlating with ROS accumulation and ATP depletion . This suggests cemA may modulate ATP synthesis or ROS scavenging pathways to mitigate oxidative stress.

Proteomic Identification

cemA was identified via a subcellular proteomic approach targeting hydrophobic envelope proteins:

  1. Purification: Chloroplast envelope membranes were extracted using chloroform/methanol (C/M) mixtures to isolate hydrophobic proteins .

  2. Mass Spectrometry: Tandem MS analysis revealed cemA among 54 envelope proteins, including 27 novel candidates .

  3. Bioinformatics: Features such as TM domains (≥4), pI >8.8, and a chloroplast transit peptide (TP) confirmed its envelope localization .

ROS and ATP Synthase Interactions

In CMS models, cemA expression inversely correlates with ATP levels and ROS accumulation, implicating it in:

  • ATP Synthase Regulation: Subunits of chloroplast ATP synthase (e.g., CF₀ and CF₁) co-express with cemA during microspore development .

  • ROS Detoxification: Downregulation of cemA may disrupt redox balance, exacerbating ROS-mediated programmed cell death in anthers .

ELISA-Based Detection

Recombinant cemA is used in ELISA kits to quantify protein levels in plant tissues, enabling studies of cemA expression under stress or developmental conditions .

Genomic and Evolutionary Context

cemA resides in the chloroplast genome of G. barbadense, which has undergone significant expansion of transposable elements (e.g., Gypsy retrotransposons) compared to its diploid progenitors . While genome-wide analyses of G. barbadense highlight gene sub-functionalization and homoeologous gene pairs , cemA’s specific evolutionary trajectory remains underexplored. Future studies could compare cemA orthologs in G. hirsutum and wild relatives to elucidate its role in cotton domestication.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate any special requirements you may have. Please include your desired format in the order notes for personalized preparation.
Lead Time
Delivery times may vary based on purchasing method and location. Please contact your local distributor for specific delivery details.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We prioritize developing the specified tag whenever possible.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Gossypium barbadense (Sea-island cotton) (Egyptian cotton)
Target Names
cemA
Target Protein Sequence
MAKKKAFTPLLYLASIVFLPWWISLSFNKSLKSWITNWWDTRQSETFLNDIQEKSILEQF IEVEELFLLDEMIKEYPETHLQKLRIGIQKETIQLIKLHNEDHIHTILHFSTNLICFVIL SGYSILGNEELLILNSWAQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSIYKD FGFTHNDQIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein is potentially involved in proton extrusion. It indirectly supports efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is cemA and where is it localized within plant cells?

CemA (Chloroplast envelope membrane protein) is a protein encoded by the chloroplast genome that uniquely localizes to the inner envelope membrane rather than the thylakoid membrane system. In maize, cemA is the sole plastid-encoded protein that localizes to the inner envelope membrane . This protein contains multiple transmembrane segments and features a distinctive lysine-rich N-terminus that resembles a bacterial signal sequence . The specific localization pattern distinguishes cemA from most other chloroplast-encoded proteins and suggests it plays specialized roles related to envelope function rather than photosynthetic reactions that typically occur in thylakoids.

How does cemA differ from other chloroplast-encoded proteins in terms of targeting mechanisms?

CemA exhibits distinct targeting behavior compared to other chloroplast-encoded proteins. While most plastid-encoded membrane proteins are directed to the thylakoid membrane, cemA specifically targets the inner envelope membrane. This unique targeting is reflected in the behavior of ribosomes translating cemA mRNA - they remain predominantly in the soluble fraction during translation despite the emergence of transmembrane segments . In contrast, ribosomes translating thylakoid proteins relocate to membranes once transmembrane segments emerge from the ribosome exit tunnel. Research in tobacco has shown that both cemA and Ycf1 (another inner envelope protein) display similar unusual ribosome behavior, suggesting a specialized targeting mechanism that distinguishes inner envelope from thylakoid proteins .

What approaches can be used to express and purify recombinant cemA for experimental studies?

For experimental studies, recombinant cemA can be expressed with appropriate tags to facilitate purification. Based on commercial preparations, recombinant cemA is typically stored in Tris-based buffer with 50% glycerol to maintain stability . The purification process must account for cemA's membrane-integrated nature, requiring detergents or other solubilizing agents to extract the protein while maintaining its native conformation. For long-term storage, the protein should be kept at -20°C or -80°C, while working aliquots can be maintained at 4°C for up to one week . Repeated freeze-thaw cycles should be avoided to preserve protein integrity and functionality.

What mechanisms prevent cemA's transmembrane segments from engaging thylakoid membranes during translation?

The unique targeting of cemA to the inner envelope raises important questions about protein sorting mechanisms in chloroplasts. Research suggests that the lysine-rich N-terminus of cemA (MKKKA...) plays a crucial role in preventing engagement with thylakoid membrane translocons . This domain either interferes with thylakoid targeting machinery or is quickly bound by factors that mask the transmembrane segments from thylakoid translocons. Notably, none of the 19 cotranslationally targeted thylakoid membrane proteins contain lysine-rich stretches preceding their first transmembrane segment . An intriguing hypothesis is that the novel Sec translocase discovered in the inner envelope might specifically mediate cemA targeting . This represents a cotranslational sorting mechanism that distinguishes inner envelope from thylakoid proteins during the translation process itself.

What is the significance of cemA's lysine-rich N-terminus in inner envelope targeting?

The lysine-rich N-terminus of cemA resembles a bacterial signal sequence and appears crucial for its proper targeting. This region consists of a lysine-rich segment followed by a predicted transmembrane segment (MKKKKALPSFLYLVFIVLLPWGVSFSF...), suggesting specific recognition by targeting machineries . While some nucleus-encoded inner envelope proteins contain serine/proline-rich domains essential for targeting, cemA lacks such regions, indicating a distinct targeting mechanism . The lysine-rich domain may function either as a positive signal for inner envelope targeting or as a negative signal preventing thylakoid engagement. The fact that this feature is maintained across diverse plant species suggests its fundamental importance in cemA's proper localization and function.

How can researchers differentiate between co-translational and post-translational targeting of cemA to the inner envelope?

The precise timing of cemA's integration into the inner envelope (co-translational vs. post-translational) remains technically challenging to determine. During chloroplast fractionation procedures, markers for the inner envelope are recovered primarily in the "soluble" fraction due to the low density of envelope membranes . This technical limitation makes it difficult to conclusively determine whether cemA integrates co-translationally or post-translationally. Researchers could address this question through several approaches:

ApproachMethodologyAdvantagesLimitations
Improved fractionation techniquesDensity gradient optimization to better separate envelope membranesDirect assessment of ribosome associationTechnical complexity and potential artifacts
Ribosome profiling with spatial resolutionDeep sequencing of membrane-bound vs. soluble ribosome footprintsHigh-resolution mapping of translation statesRequires specialized equipment and analysis
In vitro translation systemsTranslation in the presence of isolated envelope membranesControlled experimental conditionsMay not fully recapitulate in vivo conditions
Fluorescent protein fusionsReal-time visualization of cemA targeting in vivoDirect observation in living systemsPotential interference with targeting signals

How does the evolution of cemA in Gossypium barbadense compare to other species?

Evolutionary analysis of cemA across plant species could provide insights into its functional importance and specialization. The conservation of key features like the lysine-rich N-terminus across diverse species including maize, tobacco, and Gossypium barbadense suggests fundamental roles in targeting and function . Comparative studies between G. barbadense and G. hirsutum could reveal whether sequence variations correlate with differences in chloroplast function or other physiological traits. G. barbadense produces higher quality cotton fiber compared to commonly grown G. hirsutum , raising questions about whether differences in chloroplast envelope proteins might indirectly influence fiber development through metabolic or developmental pathways.

What techniques are most effective for studying cemA-protein interactions within the chloroplast inner envelope?

Studying cemA's interactions within the chloroplast inner envelope requires specialized approaches for membrane proteins. Researchers could employ:

  • Proximity-based labeling methods (BioID, APEX) where cemA is fused to a promiscuous biotin ligase to identify nearby proteins

  • Cross-linking mass spectrometry (XL-MS) to capture transient interactions within the native membrane environment

  • Co-immunoprecipitation with cemA-specific antibodies followed by mass spectrometry

  • Split-protein complementation assays (split-GFP, split-ubiquitin) modified for chloroplast expression

  • Förster resonance energy transfer (FRET) to visualize protein interactions in vivo

These approaches would help elucidate cemA's integration within inner envelope protein complexes and potentially reveal functional partners involved in its targeting or activities.

How can researchers effectively study the dynamics of cemA targeting in vivo?

Studying cemA targeting dynamics requires techniques that can track the protein from synthesis to final localization. Recommended approaches include:

  • Pulse-chase experiments with radiolabeled amino acids followed by chloroplast fractionation

  • Inducible expression systems combined with time-course analyses of localization

  • Import assays using isolated chloroplasts and recombinant cemA

  • Fluorescent protein fusions with photoactivatable tags for real-time tracking

  • Single-molecule tracking to observe individual targeting events

When analyzing targeting, researchers should consider the unusual behavior of ribosomes translating cemA, which remain predominantly in soluble fractions despite the emergence of transmembrane segments . This suggests unique targeting mechanisms distinct from those used by thylakoid proteins.

What experimental approaches can assess the functional significance of cemA in Gossypium barbadense?

Understanding cemA's functional significance in G. barbadense requires approaches that can manipulate gene expression or protein function. Researchers could employ:

  • Chloroplast transformation to introduce modified cemA variants

  • CRISPR-based approaches targeted to the chloroplast genome

  • Antisense or RNAi strategies to reduce cemA expression

  • In vitro culture systems for G. barbadense that allow chemical treatments affecting chloroplast function

  • Comparative phenotypic analyses between plants with wild-type and modified cemA

When working with G. barbadense, researchers should consider the novel ovule culture method that has been developed for this species, which could facilitate experimental manipulations and analyses . This method includes the use of fluridone, which has positive impacts on the number of useful ovules and fiber length in culture .

How can researchers differentiate between the roles of cemA and other envelope proteins in functional assays?

Differentiating cemA's specific functions from those of other envelope proteins requires careful experimental design:

  • Creation of conditional mutants or knockdowns specific to cemA

  • Complementation studies with modified cemA variants to identify functional domains

  • Comparative analyses between species with natural variations in cemA sequence

  • Metabolic profiling to identify pathways affected by cemA perturbation

  • Synthetic biology approaches replacing cemA with functionally related proteins

These approaches would help isolate cemA's contributions to inner envelope function from those of other proteins. When designing such experiments, researchers should consider that most chloroplast genomes encode only one or two proteins (cemA and potentially Ycf1) that localize to the inner envelope , making cemA a relatively unique target for functional studies.

How does cemA targeting differ from typical chloroplast protein targeting pathways?

CemA targeting represents a departure from typical chloroplast protein targeting pathways. Most plastid-encoded proteins are either synthesized directly in the stroma (for stromal proteins) or cotranslationally targeted to thylakoid membranes once transmembrane segments emerge from the ribosome . In contrast, cemA synthesis shows distinct behavior - ribosomes translating cemA remain predominantly in the soluble fraction despite the emergence of transmembrane segments . This suggests either a novel cotranslational mechanism that specifically directs cemA to the inner envelope or a post-translational mechanism that involves soluble intermediates. Unlike nucleus-encoded inner envelope proteins that follow the "stop-transfer" or "conservative sorting" pathways after import, plastid-encoded cemA must use indigenous targeting mechanisms that evolved from the original prokaryotic endosymbiont .

What can cemA targeting teach us about the evolution of protein sorting in chloroplasts?

The unique targeting pathway of cemA provides important insights into the evolution of protein sorting within chloroplasts. As one of few plastid-encoded proteins directed to the inner envelope, cemA may represent an ancestral targeting mechanism inherited from the cyanobacterial endosymbiont . The lysine-rich N-terminus resembling a bacterial signal sequence supports this evolutionary link . This suggests that as the majority of original endosymbiont genes transferred to the nucleus, proteins like cemA maintained their original targeting mechanisms while continuing to be encoded in the plastid genome. Comparative analysis across diverse plant species could reveal how these targeting mechanisms evolved alongside changes in chloroplast membrane organization and function. The conservation of cemA's unusual ribosome behavior across evolutionarily distant species like maize and tobacco suggests fundamental constraints on inner envelope protein targeting that have been maintained throughout plant evolution .

How might cemA research inform studies of chloroplast membrane biogenesis in cotton species?

Research on cemA could provide valuable insights into chloroplast membrane biogenesis in cotton species and potentially connect to fiber development traits. G. barbadense produces higher quality cotton fiber compared to commonly grown G. hirsutum , raising questions about whether differences in chloroplast function might contribute to these quality differences. Chloroplasts play essential roles in providing metabolic precursors and energy for fiber development. Since cemA is located in the inner envelope membrane, which controls metabolite transport between the chloroplast and cytosol, variations in cemA structure or function might impact these processes. Novel ovule culture methods for G. barbadense now enable experimental approaches to study these potential connections . Researchers could explore whether cemA sequence variations between cotton species correlate with differences in chloroplast membrane composition, metabolism, or fiber development patterns.

What potential connections exist between chloroplast envelope proteins and cotton fiber development?

The potential relationship between chloroplast envelope proteins like cemA and cotton fiber development represents an intriguing area for investigation. Cotton fibers undergo extensive elongation and secondary wall thickening during development, processes that require substantial metabolic resources . Since the chloroplast inner envelope, where cemA resides, controls the exchange of metabolites between the chloroplast and cytosol, variations in envelope composition could influence these developmental processes. Research has shown that G. barbadense produces higher quality cotton fiber compared to G. hirsutum , but the potential contributions of chloroplast function to these differences remain underexplored. The novel method for culturing G. barbadense ovules now enables experimental approaches to investigate these connections .

How might comparative studies of cemA across cotton species inform our understanding of both chloroplast function and fiber quality?

Comparative studies of cemA across cotton species could provide insights into both chloroplast evolution and potential contributions to fiber quality traits. Researchers could:

  • Compare cemA sequences between G. barbadense and G. hirsutum to identify variations that might correlate with phenotypic differences

  • Analyze cemA expression patterns during fiber development stages in both species

  • Investigate whether differences in chloroplast envelope composition affect metabolite transport relevant to fiber development

  • Examine how variations in cemA might influence chloroplast responses to environmental stresses that affect fiber quality

  • Develop transgenic approaches to express cemA variants and assess effects on chloroplast function and fiber development

Such comparative approaches would bridge fundamental research on chloroplast biology with applied studies relevant to cotton improvement .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.