Recombinant Gossypium barbadense Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Gossypium barbadense Cytochrome b6-f Complex Subunit 4 (petD)

Gossypium barbadense, commonly known as Egyptian cotton or Sea-island cotton, is a species of cotton prized for its extra-long staple fibers . Recombinant Gossypium barbadense Cytochrome b6-f complex subunit 4 (petD) is a protein component of the cytochrome b6-f complex, which is essential for photosynthetic electron transport in plants . The cytochrome b6-f complex acts as a vital link for electron transport between photosystems I and II during oxygenic photosynthesis . PetD is one of eight subunits constituting the cytochrome b6-f complex .

Basic Information

PropertyDescription
Chemical NameRecombinant Gossypium barbadense Cytochrome b6-f complex subunit 4 (petD)
SpeciesGossypium barbadense (Sea-island cotton) (Egyptian cotton)
Product TypeRecombinant Protein
Uniprot NO.A0ZZ66
Gene NamepetD
Expression Region1-160
Molecular Weight0
AA SequenceMGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVFLMVSVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF

Function and Significance

The PetD subunit plays a crucial role in stabilizing and ensuring the proper function of the cytochrome b6-f complex . This complex mediates electron transfer between Photosystem II and Photosystem I, which is essential for photosynthesis . Research indicates that PetM, a subunit of the cytochrome b6-f complex, is essential for the complex's stabilization and function in Arabidopsis . A study on Arabidopsis thaliana showed that a PetM mutant exhibited a bleached phenotype, impaired photosynthetic electron transport, and loss of photo-autotrophy, similar to a PetC mutant .

Genomic Insights of Gossypium barbadense

The Gossypium genus includes 45 diploid and six tetraploid species . Gossypium barbadense is a tetraploid species . The G. barbadense genome offers insights into allopolyploidy and facilitates the improvement of cotton fiber quality . The G. barbadense genome has a high level of co-linearity with the G. raimondii genome in both its At and Dt subgenomes .

Potential Applications

Recombinant Gossypium barbadense Cytochrome b6-f complex subunit 4 (petD) is valuable in various research applications:

  • ** изучение фотосинтеза:** Facilitates research on the photosynthetic mechanisms in plants .

  • Crop Improvement: Understanding the role of petD can aid in improving cotton fiber quality and yield .

  • Biotechnology: Useful in creating genetically modified crops with enhanced photosynthetic efficiency .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Gossypium barbadense (Sea-island cotton) (Egyptian cotton)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVFLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function

Function: A component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and structure of the petD gene in Gossypium barbadense?

The petD gene in G. barbadense is located within the chloroplast genome. Based on genomic studies of G. barbadense, the gene follows the typical organization of angiosperm chloroplast genes. The genome of G. barbadense has been sequenced and assembled to a high quality with 2.57 gigabases (Gb), including the A (At) subgenome (1.50 Gb) and D (Dt) subgenome (853 Mb) . To accurately locate the petD gene:

  • Utilize the complete genome sequence to identify the chloroplast genome segment.

  • Apply genome annotation tools specific for organellar genomes, as the petD gene would be found in the chloroplast DNA rather than nuclear DNA.

  • Examine the sequence for the characteristic features of the petD gene, which typically encodes a protein of approximately 17 kDa that functions as subunit 4 of the cytochrome b6-f complex.

How does the petD gene product function within the cytochrome b6-f complex?

The petD gene encodes subunit 4 of the cytochrome b6-f complex, which is integral to photosynthetic electron transport. Within this complex:

  • The cytochrome b6-f complex occupies a central position in the electron transport chain, oxidizing plastoquinol (PQH2) and providing electron transfer between Photosystems II and I .

  • This electron transfer is coupled to proton (H+) transfer across the thylakoid membrane, contributing to the establishment of a proton gradient necessary for ATP synthesis .

  • The complex functions as a dimer containing 8 tightly bound subunits per monomer in cyanobacteria (M. laminosus) and 9 in plant chloroplasts, with total monomer molecular weight of approximately 108,500 Da .

  • The petD-encoded subunit contributes to the structural integrity of the complex and participates in forming the plastoquinol oxidation site.

What expression patterns does the petD gene exhibit in Gossypium barbadense tissues?

The expression of petD in G. barbadense follows tissue-specific and developmental patterns characteristic of chloroplast genes involved in photosynthesis:

  • Highest expression occurs in photosynthetically active tissues, primarily leaves.

  • Expression is regulated by light conditions, with upregulation in response to light exposure.

  • The expression patterns may be coordinated with other photosynthetic genes, including nuclear-encoded components of the electron transport chain.

  • In transcriptomic studies of G. barbadense, chloroplast genes show specific expression patterns that differ from those observed in G. hirsutum, potentially contributing to physiological differences between these cotton species .

How has the petD gene evolved in Gossypium barbadense compared to other cotton species?

Evolutionary analysis of the petD gene reveals patterns of conservation and divergence within the Gossypium genus:

  • Comparative genomic studies between G. barbadense and G. hirsutum show that despite their shared allotetraploid nature (containing both A and D subgenomes), there are distinctions in photosynthetic gene organization and regulation .

  • The evolution of the petD gene should be examined in the context of polyploidization events that shaped the Gossypium genus. The allotetraploid genome of G. barbadense resulted from hybridization between A and D genome ancestors, followed by genome doubling .

  • Sequence analysis of petD across Gossypium species can identify conserved domains essential for function versus regions that may have undergone species-specific adaptation.

  • Evolutionary rate analysis can determine whether petD has been subject to purifying selection (typical for essential genes) or shows evidence of adaptive evolution in G. barbadense.

What role does the petD gene product play in the superior fiber development characteristics of Gossypium barbadense?

G. barbadense is valued for its superior fiber properties compared to other cotton species. The relationship between photosynthetic efficiency and fiber development involves:

How do mutations in the petD gene affect photosynthetic efficiency in Gossypium barbadense?

Mutations in the petD gene can have significant impacts on photosynthetic performance:

  • Null mutations that completely eliminate functional petD protein would likely be lethal or severely impair plant viability due to the essential nature of the cytochrome b6-f complex in electron transport.

  • Missense mutations affecting key functional domains may reduce electron transport efficiency, resulting in decreased photosynthetic rate and reduced growth.

  • Regulatory region mutations could alter expression levels or patterns, potentially creating imbalances in the stoichiometry of the cytochrome b6-f complex components.

  • The effect of petD mutations should be evaluated in the context of the integrated regulatory mechanism involving genes from both At and Dt subgenomes that control photosynthetic processes in G. barbadense .

What are the optimal conditions for cloning and expressing recombinant G. barbadense petD?

For successful cloning and expression of recombinant G. barbadense petD:

  • Source material selection:

    • Use young, actively photosynthesizing leaves of G. barbadense for RNA extraction.

    • Consider tissue-specific expression patterns when selecting source material.

  • Cloning strategy:

    • Create a codon-optimized synthetic gene based on the chloroplast petD sequence to improve expression in prokaryotic systems.

    • Include appropriate tags (His, GST, etc.) to facilitate purification while minimizing interference with protein folding.

    • Select expression vectors with promoters suitable for membrane protein expression.

  • Expression systems:

    • For functional studies, consider chloroplast transformation systems.

    • For structural studies, bacterial expression systems with membrane protein optimization.

    • Yeast or insect cell systems may provide better post-translational processing for eukaryotic expression.

  • Expression conditions:

    • Induce expression at lower temperatures (16-20°C) to improve folding of membrane proteins.

    • Consider using specialized E. coli strains designed for membrane protein expression.

    • Monitor expression using Western blotting with antibodies against the fusion tag or the petD protein.

What approaches can be used to analyze the interaction between recombinant petD and other cytochrome b6-f complex subunits?

To investigate protein-protein interactions within the cytochrome b6-f complex:

  • Co-immunoprecipitation studies:

    • Express tagged versions of petD and other subunits.

    • Perform pull-down assays to identify interaction partners.

    • Verify specificity with appropriate controls including tag-only constructs.

  • Yeast two-hybrid or split-ubiquitin assays:

    • Adapted for membrane proteins to detect binary interactions.

    • Map interaction domains through truncation or mutation analysis.

  • Cryo-electron microscopy:

    • Reconstitute the complex with recombinant components.

    • Determine the structural arrangement of subunits.

    • Compare with known structures from other species.

  • Crosslinking mass spectrometry:

    • Use chemical crosslinkers to capture protein interactions.

    • Identify crosslinked peptides to map interaction interfaces.

    • Can detect transient or weak interactions not captured by other methods.

How can gene editing techniques be applied to study petD function in Gossypium barbadense?

CRISPR/Cas9 and other gene editing approaches for studying petD function:

  • Chloroplast transformation approaches:

    • Design a chloroplast transformation vector targeting the petD gene.

    • Create specific mutations to study structure-function relationships.

    • Analyze phenotypic effects on photosynthesis and plant development.

  • Nuclear-encoded regulators:

    • Identify and edit nuclear genes that regulate petD expression.

    • Create conditional knockdown lines to avoid lethality.

    • Use inducible promoters to control the timing of gene silencing.

  • Reporter gene fusions:

    • Create petD promoter-reporter constructs to study expression patterns.

    • Analyze regulatory elements controlling tissue-specific expression.

    • Monitor responses to various physiological and environmental conditions.

  • Complementation studies:

    • Rescue mutant phenotypes with variant forms of petD to identify essential domains.

    • Perform cross-species complementation to study functional conservation.

What techniques are most effective for purifying the recombinant petD protein for structural studies?

Purification of membrane proteins like petD requires specialized approaches:

  • Solubilization optimization:

    • Test multiple detergents (DDM, LMNG, digitonin) at various concentrations.

    • Evaluate stability using size-exclusion chromatography profiles.

    • Consider nanodiscs or amphipols for maintaining native-like environment.

  • Purification strategy:

    • Implement a multi-step purification approach:
      a. Affinity chromatography using engineered tags
      b. Ion exchange chromatography
      c. Size exclusion chromatography for final polishing

    • Monitor protein quality using SDS-PAGE and Western blotting.

  • Structural integrity verification:

    • Circular dichroism to assess secondary structure content.

    • Limited proteolysis to evaluate folding quality.

    • Thermal shift assays to measure stability in various conditions.

  • Reconstitution methods:

    • For functional studies, reconstitute into liposomes.

    • For structural studies, consider crystallization in lipidic cubic phase.

    • For cryo-EM, use approaches optimized for membrane protein complexes.

How can researchers analyze the transcriptional regulation of the petD gene in Gossypium barbadense?

Understanding transcriptional regulation requires multiple approaches:

  • RNA-Seq analysis:

    • Compare expression patterns across different tissues and developmental stages.

    • Correlate with the expression of other photosynthetic genes.

    • Look for G. barbadense-specific expression patterns compared to other cotton species.

  • Promoter analysis:

    • Identify regulatory elements in the upstream region.

    • Perform deletion analysis to map essential regulatory regions.

    • Use reporter gene assays to verify functional elements.

  • Transcription factor identification:

    • Perform chromatin immunoprecipitation (ChIP) to identify proteins binding to the promoter.

    • Use yeast one-hybrid assays to screen for interacting transcription factors.

    • Validate interactions with electrophoretic mobility shift assays (EMSA).

  • Epigenetic regulation:

    • Analyze DNA methylation patterns around the petD gene.

    • Examine chromatin accessibility using techniques like ATAC-seq.

    • Consider the influence of polyploidy on epigenetic regulation in G. barbadense.

What methods should be used to assess the impact of petD variation on photosynthetic efficiency?

To evaluate how petD variants affect photosynthetic performance:

  • Chlorophyll fluorescence measurements:

    • Measure parameters including Fv/Fm (maximum quantum efficiency) and ΦPSII (effective quantum yield).

    • Perform induction curves to assess electron transport dynamics.

    • Use rapid light curves to evaluate photosynthetic capacity across light intensities.

  • Gas exchange analysis:

    • Measure CO2 assimilation rates under controlled conditions.

    • Determine light and CO2 response curves.

    • Calculate photosynthetic parameters including Vcmax and Jmax.

  • Spectroscopic techniques:

    • Measure P700 oxidation kinetics to assess PSI function.

    • Use absorption spectroscopy to monitor cytochrome complex redox states.

    • Implement electron paramagnetic resonance (EPR) to study electron transport components.

  • Growth and yield analysis:

    • Compare biomass accumulation rates under controlled conditions.

    • Assess photosynthetic efficiency under various environmental stresses.

    • Evaluate the relationship between photosynthetic parameters and fiber development.

How does the petD gene differ between the At and Dt subgenomes in Gossypium barbadense?

Analyzing subgenome differences in petD:

  • The genome of G. barbadense contains both At (1.50 Gb) and Dt (853 Mb) subgenomes, with the At subgenome being substantially larger primarily due to the expansion of Gypsy elements, specifically Peabody and Retrosat2 subclades in the Del clade and the Athila subclade .

  • Substantial gene expansion and contraction have been observed between the subgenomes, with biased expression patterns identified in homoeologous gene pairs, suggesting gene sub-functionalization following allopolyploidization .

  • In analyzing photosynthetic genes, researchers should examine:

    • Sequence divergence between At and Dt copies

    • Expression biases between subgenome copies

    • Potential functional differentiation

  • For chloroplast-encoded genes like petD, interactions with nuclear factors from both subgenomes may create complex regulatory networks that differ from those in diploid species.

How do the structures and functions of petD compare between Gossypium barbadense and other plant species?

Comparative analysis across species:

  • Sequence conservation analysis:

    • Compare petD sequences across diverse photosynthetic organisms.

    • Identify universally conserved residues versus lineage-specific variations.

    • Map conservation patterns onto structural models to identify functional domains.

  • Functional comparisons:

    • The cytochrome b6-f complex performs similar functions across photosynthetic organisms, oxidizing plastoquinol and facilitating electron transfer between photosystems .

    • Species-specific adaptations may exist in regulatory mechanisms or protein-protein interactions.

    • Cotton-specific variations may relate to adaptation to particular environmental conditions.

  • Structural considerations:

    • The cytochrome b6-f complex typically functions as a dimer with 8-9 subunits per monomer .

    • Structural differences between species may affect electron transfer efficiency or regulation.

    • G. barbadense petD should be compared to both close relatives (other Gossypium species) and more distant plant lineages.

SpeciespetD Length (aa)Key Structural FeaturesNotable Functional Adaptations
G. barbadense~160*Membrane-spanning domainsAdapted for efficient photosynthesis in cotton-specific conditions
G. hirsutum~160*High similarity to G. barbadensePotentially different regulation related to fiber development
Arabidopsis thaliana160Conserved core structureModel for basic photosynthetic functions
Spinacia oleracea160Well-studied in structural analysesUsed in many foundational studies of b6-f complex
Cyanobacteria155-160More ancient formRepresents ancestral state of the complex

*Estimated based on typical plant petD genes; exact length may vary

What can be learned from comparing recombinant expression systems for petD from different Gossypium species?

Comparative expression system analysis:

  • Expression efficiency comparison:

    • Test whether petD from G. barbadense expresses with different efficiency than orthologs from other cotton species.

    • Identify sequence features that may affect expression levels or protein stability.

    • Optimize expression conditions for each ortholog.

  • Functional complementation:

    • Test whether petD from different Gossypium species can functionally substitute for each other.

    • Identify species-specific functional adaptations through cross-species complementation.

    • Evaluate the effects on photosynthetic efficiency and electron transport rates.

  • Structural differences:

    • Compare folding efficiency and stability of recombinant proteins.

    • Identify regions prone to misfolding or aggregation.

    • Engineer chimeric proteins to map species-specific properties.

  • Interaction profiles:

    • Compare the ability of petD from different species to interact with other subunits of the cytochrome b6-f complex.

    • Identify species-specific interaction partners that may reveal functional adaptations.

How should researchers interpret differences in electron transport rates when comparing native and recombinant petD proteins?

When comparing native and recombinant forms:

  • Sources of variation:

    • Recombinant proteins may lack post-translational modifications present in native forms.

    • Expression tags can interfere with function or interactions.

    • Lipid environment differences between native membranes and reconstituted systems.

    • Potential folding differences affecting protein dynamics.

  • Standardization approaches:

    • Normalize measurements to protein concentration.

    • Use internal controls with known electron transport rates.

    • Perform measurements under identical conditions (temperature, pH, substrates).

    • When possible, compare within the same membrane environment.

  • Validation methods:

    • Perform multiple independent preparations to assess reproducibility.

    • Use complementary assays measuring different aspects of electron transport.

    • Implement controls with site-directed mutations at known functional residues.

  • Interpretation framework:

    • Consider kinetic parameters (Km, Vmax) rather than just absolute rates.

    • Examine the response to inhibitors to verify mechanistic similarities.

    • Assess protein stability during assays to rule out degradation effects.

What are common pitfalls in analyzing the integration of recombinant petD into the cytochrome b6-f complex?

Common challenges and solutions:

  • Incomplete complex assembly:

    • Verify stoichiometry of all subunits using quantitative proteomics.

    • Check for missing components using antibodies against each subunit.

    • Assess complex integrity using native PAGE or size exclusion chromatography.

  • Improper cofactor incorporation:

    • Verify heme and iron-sulfur cluster incorporation using absorption spectroscopy.

    • Supplement expression systems with relevant cofactors.

    • Consider co-expression with assembly factors.

  • Membrane integration issues:

    • Confirm proper membrane topology using protease protection assays.

    • Analyze detergent-solubilized versus membrane-reconstituted preparations.

    • Verify lipid composition of reconstituted systems compared to native membranes.

  • Functional artifacts:

    • Distinguish between specific activity and total activity measurements.

    • Control for non-specific electron transfer pathways.

    • Verify that measured activities reflect the known mechanism of the complex.

How can researchers troubleshoot expression problems with recombinant G. barbadense petD?

Troubleshooting strategies:

  • Low expression levels:

    • Optimize codon usage for the expression host.

    • Test different promoter strengths and induction conditions.

    • Evaluate mRNA stability and translation efficiency.

    • Consider fusion partners known to enhance membrane protein expression.

  • Protein aggregation:

    • Reduce expression temperature and induction levels.

    • Test different detergents for membrane extraction.

    • Add stabilizing agents during purification.

    • Use solubility-enhancing fusion partners.

  • Degradation issues:

    • Add protease inhibitors during extraction and purification.

    • Use protease-deficient expression hosts.

    • Identify and modify protease-sensitive regions.

    • Optimize buffer conditions to enhance stability.

  • Verification approaches:

    • Use multiple detection methods (Western blot, mass spectrometry, activity assays).

    • Compare results across different expression systems.

    • Implement controls with known expression properties.

What emerging technologies could advance our understanding of petD function in Gossypium barbadense?

Cutting-edge approaches with potential impact:

  • CryoEM for structural analysis:

    • Recent advances in cryoEM technology enable atomic-resolution structures of membrane protein complexes.

    • Apply to determine G. barbadense-specific features of the cytochrome b6-f complex.

    • Compare structures under different physiological conditions to capture dynamic states.

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to study protein dynamics.

    • Optical tweezers to measure forces involved in electron transport processes.

    • Single-molecule electrophysiology to capture individual electron transfer events.

  • Advanced genome editing:

    • Prime editing for precise modifications of petD and interacting genes.

    • Multiplex CRISPR systems to study genetic interactions.

    • Optogenetic control of gene expression to study temporal dynamics.

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to understand petD in cellular context.

    • Machine learning to predict effects of sequence variations on function.

    • Synthetic biology approaches to redesign aspects of the electron transport chain.

How might research on petD contribute to improving cotton fiber quality and yield?

Translational research opportunities:

  • Photosynthetic efficiency and fiber development:

    • Investigate the relationship between electron transport efficiency and carbon allocation to fiber.

    • Study how petD variants correlate with fiber quality traits across G. barbadense cultivars.

    • Determine whether optimized electron transport can extend the fiber elongation phase.

  • Stress tolerance connections:

    • Examine how petD function relates to photosynthetic maintenance under stress conditions.

    • Develop markers for selecting cotton varieties with robust electron transport under adverse conditions.

    • Investigate whether specific petD variants confer advantages during the critical fiber development period.

  • Genetic resources development:

    • Create a panel of petD variants for testing in different genetic backgrounds.

    • Develop non-invasive phenotyping methods to correlate photosynthetic parameters with fiber quality.

    • Establish germplasm resources preserving natural variation in petD and related genes.

  • Modeling approaches:

    • Develop quantitative models linking photosynthetic efficiency to fiber development.

    • Create predictive frameworks for identifying beneficial petD variants.

    • Model the energetic costs and benefits of different electron transport configurations.

What are the most promising approaches for engineering enhanced photosynthetic efficiency through petD modifications?

Strategic engineering approaches:

  • Targeted amino acid substitutions:

    • Modify residues involved in quinol binding to alter substrate affinity.

    • Engineer proton transfer pathways to optimize coupling efficiency.

    • Alter subunit interfaces to enhance stability under stress conditions.

  • Regulatory enhancements:

    • Modify expression patterns to improve coordination with other photosynthetic components.

    • Engineer regulatory elements for optimal response to environmental conditions.

    • Create synthetic regulatory circuits for demand-based expression.

  • Cross-species optimization:

    • Identify naturally occurring petD variants with superior properties.

    • Create chimeric proteins incorporating advantageous features from different species.

    • Test whether non-plant petD variants could offer novel functionalities.

  • Integration with other enhancements:

    • Combine petD modifications with other photosynthetic improvements.

    • Evaluate how petD engineering interacts with modifications to other electron transport components.

    • Develop comprehensive strategies addressing multiple limiting factors in photosynthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.