Recombinant Gossypium barbadense Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is preferred, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Gossypium barbadense (Sea-island cotton) (Egyptian cotton)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 (petB) and what is its functional role in Gossypium barbadense?

Cytochrome b6, encoded by the petB gene, is a critical component of the cytochrome b6f complex located in the thylakoid membrane of chloroplasts in Gossypium barbadense (Sea-island cotton). This protein plays an essential role in photosynthetic electron transport, mediating electron transfer between photosystem II and photosystem I. In G. barbadense, Cytochrome b6 contributes to energy production crucial for various physiological processes, including fiber development. The protein is also known by its gene name petB, as indicated in commercial recombinant protein specifications .

What expression systems are available for producing recombinant G. barbadense Cytochrome b6?

Recombinant G. barbadense Cytochrome b6 can be produced using multiple expression systems, each with distinct advantages depending on research requirements:

Expression SystemProduct CodeSpecial FeaturesApplications
YeastCSB-YP372069GEP1Post-translational modificationsStructural studies
E. coliCSB-EP372069GEP1High yield, cost-effectiveFunctional assays, antibody production
E. coli (Biotinylated)CSB-EP372069GEP1-BAvi-tag BiotinylatedProtein interaction studies
BaculovirusCSB-BP372069GEP1Insect cell expressionComplex protein folding
Mammalian cellCSB-MP372069GEP1Native-like modificationsSignal transduction studies

The E. coli biotinylated system employs AviTag-BirA technology, where E. coli biotin ligase (BirA) specifically attaches biotin to the 15 amino acid AviTag peptide via an amide linkage between biotin and the specific lysine of the AviTag .

What are the optimal storage and reconstitution protocols for recombinant G. barbadense Cytochrome b6?

For optimal storage and reconstitution of recombinant G. barbadense Cytochrome b6:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default is 50%)

  • Aliquot for long-term storage at -20°C/-80°C

This methodology preserves protein structure and function while preventing freeze-thaw degradation .

How has introgression from G. hirsutum affected the genetic architecture of G. barbadense?

Interspecific introgression from Gossypium hirsutum has significantly reorganized the genomic architecture of G. barbadense during domestication and improvement processes. Research has identified 315 distinct introgression events from G. hirsutum to G. barbadense, which have primarily contributed to population divergence and agronomic trait variation. Approximately 70% of these introgressions have substantially increased genetic diversity and divergence in G. barbadense populations .

Genetic analysis has revealed that these introgressions have led to:

  • Population recategorization into four distinct subgroups

  • Enhanced adaptation to environments at high latitudes through divergent haplotype selection

  • Improved fiber micronaire traits through specific introgressed haplotype blocks (e.g., FM2)

  • Pleiotropic effects controlling seven distinguished traits related to growth period, plant architecture, and vegetative growth habits

How do genetic variations in G. barbadense relate to fiber quality traits?

Genetic variations in G. barbadense show significant correlations with fiber quality traits. Analysis of recombinant inbred mapping populations has demonstrated:

Fiber Quality TraitRange in Mapping PopulationSignificance
Fiber length24.91 to 34.06 mmCritical for textile strength
Fiber strength25.02 to 35.86 g/texDetermines processing durability
Micronaire2.89–4.57Indicates fiber fineness
Uniformity index64.08–98.83Reflects consistency of fiber
Fiber elongation5.37–6.60Elasticity measure
Maturity ratio0.48–0.76Fiber wall development

Principal component analysis indicates that principal component-1 explains 23.12% of variance with maximum Eigen vector values for fiber strength (-0.464), length (-0.469), elongation (-0.448), maturity ratio (0.312), and micronaire (0.306). Correlation analysis further demonstrates that fiber length and strength can be simultaneously improved without negatively impacting seed cotton yield, as these traits are positively associated .

How does herbivore infestation affect gene expression in G. barbadense?

Transcriptome analysis reveals comprehensive reprogramming of gene expression in G. barbadense following herbivore attack. When infested with Helicoverpa armigera larvae, G. barbadense exhibits 5,629 differentially expressed genes (DEGs) compared to non-infested controls. This response includes:

  • Upregulation of 88 out of 90 DEGs associated with the jasmonic acid (JA) pathway, highlighting JA's central role in defense

  • Downregulation of all DEGs involved in growth-related photosynthesis

  • Upregulation of most DEGs associated with defense-related transcription factors

  • Significant enhancement of volatile secondary metabolism genes

These transcriptional changes demonstrate the sophisticated molecular machinery activated during biotic stress, which may involve cytochrome components in signaling cascades or energy allocation processes.

What is the relationship between terpene synthases and defense in G. barbadense?

In G. barbadense, terpene synthases play crucial roles in herbivore-induced defense mechanisms. The terpene synthase gene GbTPS1 is strongly expressed in H. armigera-infested leaves, suggesting an important defensive function. Recombinant GbTPS1 catalyzes:

  • Farnesyl pyrophosphate to produce three sesquiterpenes (selinene, α-gurjunene, and β-elemene)

  • Neryl diphosphate to produce one monoterpene (limonene)

These catalytic products significantly increase in G. barbadense leaves after H. armigera infestation. Bioassays demonstrate that elemene and limonene have repellent effects on H. armigera larvae and increase larval mortality .

This defense pathway may interact with chloroplast-based processes involving Cytochrome b6, as photosynthesis regulation and secondary metabolite production are often linked during stress responses.

What are the optimal methods for purifying recombinant G. barbadense Cytochrome b6?

Purification of recombinant G. barbadense Cytochrome b6 typically achieves >85% purity using SDS-PAGE analysis . The recommended purification protocol includes:

  • Cell lysis under optimized buffer conditions

  • Initial capture using affinity chromatography based on the specific tag

  • Further purification via ion exchange chromatography

  • Size exclusion chromatography for final polishing

  • Quality assessment using SDS-PAGE and Western blotting

For E. coli-expressed biotinylated protein, streptavidin-based affinity purification provides high specificity and yield.

How can researchers validate the functionality of recombinant G. barbadense Cytochrome b6?

Functional validation of recombinant G. barbadense Cytochrome b6 can be performed through:

  • Spectroscopic analysis to assess heme incorporation and redox properties

  • Electron transfer assays using artificial electron donors/acceptors

  • Reconstitution experiments with other components of the cytochrome b6f complex

  • Protein-protein interaction studies with known binding partners

  • In vitro activity assays measuring electron transport capacity

These methodologies enable researchers to confirm that the recombinant protein maintains native-like structure and function.

How can recombinant G. barbadense Cytochrome b6 be used to study cotton adaptation to environmental stress?

Recombinant G. barbadense Cytochrome b6 provides a valuable tool for investigating adaptation mechanisms to environmental stress through:

  • Comparative structure-function analysis between G. barbadense and other cotton species

  • Site-directed mutagenesis to mimic natural variations identified in stress-tolerant populations

  • Protein interaction studies to map stress-responsive signaling networks

  • In vitro assays under varying conditions (temperature, pH, salt) to assess stability differences

  • Correlation of specific petB variants with adaptations to high-latitude environments

This research direction is particularly valuable given the identification of divergent haplotype selection for adaptation to environments at high latitudes in G. barbadense populations.

What are the challenges in correlating Cytochrome b6 variations with fiber quality traits?

Correlating Cytochrome b6 variations with fiber quality traits presents several methodological challenges:

  • Pleiotropic effects - single genes can influence multiple traits, as demonstrated by the control of seven distinguished traits by a single gene in G. barbadense

  • Complex trait architecture - fiber quality characteristics are typically polygenic

  • Environmental interactions - gene expression varies under different growing conditions

  • Tissue specificity - determining whether observed effects are direct or indirect

  • Temporal dynamics - critical developmental windows when Cytochrome b6 function impacts fiber development

Addressing these challenges requires integrated approaches combining genetics, biochemistry, and physiology to establish causal relationships between protein variants and phenotypic outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.