Recombinant Gossypium barbadense Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Gossypium barbadense Cytochrome c Biogenesis Protein ccsA

Cytochrome c biogenesis protein ccsA is a transmembrane protein found in Gossypium barbadense, commonly known as Sea-island cotton or Egyptian cotton. This protein plays a fundamental role in the maturation of cytochrome c, a ubiquitous heme protein essential for energy metabolism in mitochondria and bacteria . In the context of Gossypium barbadense, cytochrome c and its biogenesis machinery are particularly relevant given this cotton species' distinctive fiber characteristics and agricultural importance.

The recombinant form of this protein (CSB-CF371619GEP) has been produced to facilitate research into its structure and function, providing insights into the unique molecular mechanisms that may contribute to the superior fiber quality of G. barbadense compared to other cotton species . Cytochrome c biogenesis systems are highly conserved across diverse organisms, yet exhibit significant species-specific variations that deserve detailed investigation.

Gossypium barbadense is recognized for its exceptional fiber quality traits, including strength, length, and fineness, which differentiate it from other cotton species like Gossypium hirsutum . Understanding the molecular basis for these differences, including the role of proteins like cytochrome c biogenesis protein ccsA, provides valuable knowledge for cotton improvement programs and biotechnological applications.

Mechanism of Action in System II

The Gossypium barbadense cytochrome c biogenesis protein ccsA functions as an integral component of cytochrome c maturation System II. This system differs significantly from System I (found in many bacteria and plant mitochondria) and System III (found in fungi and animals) . In System II, the CcsBA complex (comprised of CcsB and CcsA proteins) performs multiple functions that are distributed among several proteins in System I.

The CcsBA complex, which includes the ccsA protein, serves dual roles: it acts as both a heme exporter and a cytochrome c synthase with two heme binding sites . This functional consolidation represents an evolutionary adaptation that distinguishes System II from the more component-heavy System I.

Research has demonstrated that a single fused ccsBA polypeptide can functionally replace the eight genes (ccmA-H) associated with System I in Escherichia coli, highlighting the remarkable efficiency of the System II pathway . This finding underscores the importance of ccsA as part of a streamlined yet highly effective mechanism for cytochrome c maturation.

Heme Binding and Transfer Mechanisms

The ccsA protein contains domains specialized for heme interaction and transfer. Studies on bacterial CcsBA complexes have revealed that heme trafficking occurs from an internal membrane site, liganded by transmembrane histidine residues, to an external domain called the WWD/P-His site . This mechanism facilitates the stereochemical attachment of heme to the characteristic CXXCH motif of apocytochrome c.

Unlike System I, which utilizes a covalently bound heme chaperone (holo-CcmE) that serves as a heme reservoir, System II (including ccsA) operates without such an intermediate . This distinction impacts how each system responds to varying heme availability, with System I being able to function at lower endogenous heme levels compared to System II.

Differences Between Plant and Bacterial Systems

The recombinant Gossypium barbadense cytochrome c biogenesis protein ccsA shares functional similarities with bacterial counterparts, yet possesses plant-specific adaptations. In vitro reconstitution studies have revealed major differences between cytochrome c biogenesis systems across different organisms .

Bacterial CcsBA systems require both thiols and histidine in the CXXCH motif for substrate recognition, whereas mammalian systems (HCCS) have different substrate recognition requirements . These fundamental differences in substrate recognition and processing mechanisms highlight the evolutionary divergence of cytochrome c biogenesis pathways.

System I vs System II Efficiency

Comparative studies between System I and System II have provided insights into their relative efficiencies and capabilities. System I requires eight proteins (CcmA-H) to accomplish what System II achieves with primarily the CcsBA complex . This streamlined architecture in System II represents an evolutionary adaptation toward functional efficiency.

Relevance to Cotton Fiber Development

The study of recombinant Gossypium barbadense cytochrome c biogenesis protein ccsA holds particular significance for understanding cotton fiber development. Gossypium barbadense is renowned for producing superior quality fibers with enhanced length, strength, and fineness compared to other cotton species like Gossypium hirsutum .

Integrated isoform-resolved transcriptomic analyses have identified significant differences in gene expression and alternative splicing events between these cotton species during fiber development . While the specific role of ccsA in determining fiber quality has not been fully elucidated, its involvement in energy metabolism through cytochrome c maturation suggests potential contributions to the energy-intensive process of fiber elongation and secondary wall thickening.

Biotechnological Applications

The recombinant production of Gossypium barbadense cytochrome c biogenesis protein ccsA enables various biotechnological applications. These include:

  1. Development of inhibitory peptides targeting cytochrome c biogenesis as potential control mechanisms for agricultural pests or pathogens

  2. Creation of molecular tools for studying electron transport chain assembly and function

  3. Engineering improved energy metabolism in cotton varieties for enhanced stress tolerance or yield

Research has shown that peptide analogs containing the CXXCH motif can act as inhibitors of cytochrome c biogenesis . This finding opens avenues for developing targeted controls based on the specific recognition requirements of different cytochrome c biogenesis systems.

Recombinant Expression Systems

The recombinant Gossypium barbadense cytochrome c biogenesis protein ccsA (product code CSB-CF371619GEP) is produced using an in vitro Escherichia coli expression system . This approach allows for the controlled production of this transmembrane protein, which might otherwise be challenging to isolate from natural sources in sufficient quantities for research purposes.

Expression strategies for membrane proteins like ccsA often require optimization to ensure proper folding and functional integrity. Various tagging approaches, such as hexahistidine tagging, have been employed for similar proteins to facilitate purification and yield enhancement .

Functional Genomics Approaches

Integration of transcriptomic, proteomic, and metabolomic data could provide a more comprehensive understanding of how ccsA contributes to cotton fiber development. The identification of 183,767 isoforms in Gossypium barbadense through long-read RNA sequencing represents a valuable resource for contextualizing ccsA expression within broader developmental programs .

Future research might explore how variations in ccsA expression or structure correlate with fiber quality traits across different cotton cultivars or under various environmental conditions. Such studies could potentially identify specific allelic variations associated with superior fiber characteristics, providing targets for marker-assisted selection in breeding programs.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Gossypium barbadense (Sea-island cotton) (Egyptian cotton)
Target Names
ccsA
Target Protein Sequence
MIFSTLEHILTHISFSVVSIVITIHFLTLFLLVDEVVGLYDSSEKGMIVTFFCITGLLVT RWIYSGHFPLSDLYESLIFLSWGFSLIHMVSYLKFKKRKNNLSAITAPRAIFTQGFATSG LLTKMHQSAILAPALQSQWLMMHVSMMVLGYAALLCGSLLSVALLVITFRKAIKIIGENN NFSFSFGKIQYMNERSNVLLNTYFLSSKNYYRYQLTQQLDRWSYRIISLGFIFLTIGILS GAVWANEAWGSYWNWDPKETWAFITWTVFAIYFHTRTNTNLEGVNSALVASMGFLIIWIC YFGVNLLGIGLHSYGSFTLN
Uniprot No.

Target Background

Function
Essential during the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the heme attachment stage.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Gossypium barbadense cytochrome c biogenesis protein ccsA and its significance in plant biology?

Gossypium barbadense cytochrome c biogenesis protein ccsA is a membrane protein involved in the maturation of c-type cytochromes, which are essential components of the electron transport chain in both respiratory and photosynthetic processes. The protein is encoded by the ccsA gene located in the chloroplast genome of G. barbadense (Sea-island cotton or Egyptian cotton), a species well known for its superior fiber properties and high resistance to Fusarium and Verticillium wilts . The ccsA protein plays a crucial role in heme attachment to apocytochromes, a process that is essential for proper electron transfer activities within the cell.

The significance of studying this protein extends beyond basic biological understanding to potential applications in cotton improvement programs, particularly in transferring G. barbadense's valuable traits to other cotton species. The protein's function is directly related to energy metabolism in plant cells, which may contribute to G. barbadense's distinctive physiological characteristics.

What expression systems are optimal for recombinant production of G. barbadense ccsA?

The expression of membrane proteins like ccsA presents significant challenges that require specialized approaches. For recombinant production of G. barbadense ccsA, researchers should consider the following expression systems, each with specific advantages:

Expression SystemAdvantagesConsiderationsYield Potential
E. coliRapid growth, economical, genetic tractabilityMay require fusion tags for proper folding, codon optimization essentialLow to moderate
Yeast (P. pastoris)Post-translational modifications, membrane protein machineryLonger expression time, glycosylation patterns differ from plantsModerate
Insect cellsSuperior folding of complex proteins, moderate scalabilityHigher cost, complex media requirementsModerate to high
Plant-based (N. benthamiana)Native-like environment, appropriate post-translational modificationsSlower process, specialized equipment neededVariable

For G. barbadense ccsA, a plant-based expression system or insect cell system would be most appropriate given the complexity of the membrane protein and its plant origin. Regardless of the system chosen, expression should include a C-terminal or N-terminal affinity tag (e.g., His6, Strep-tag) for purification, with a cleavable linker to allow tag removal if needed for functional studies.

Codon optimization for the expression host is essential, as is the inclusion of appropriate signal sequences to direct the protein to the membrane fraction. For bacterial expression, fusion partners such as MBP (maltose-binding protein) or SUMO may improve solubility and proper folding.

What are the most effective purification strategies for recombinant ccsA protein?

Purification of membrane proteins like ccsA requires specialized approaches:

  • Membrane Isolation and Solubilization:

    • Harvest cells and disrupt by sonication or French press

    • Isolate membranes by differential centrifugation

    • Solubilize using mild detergents (start with 1% n-dodecyl-β-D-maltoside (DDM), CHAPS, or digitonin)

    • Optimize detergent concentration by testing protein activity and stability

  • Affinity Chromatography:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Use gradient elution (50-500 mM imidazole) to minimize co-purifying contaminants

    • Include detergent throughout purification (typically at CMC + 0.05%)

  • Size Exclusion Chromatography:

    • Further purify by gel filtration to remove aggregates and achieve higher purity

    • Can also provide information about protein oligomeric state

  • Reconstitution into Nanodiscs or Liposomes:

    • For functional studies, reconstitute purified protein into artificial membrane systems

    • MSP (membrane scaffold protein) nanodiscs provide a defined membrane environment

Throughout purification, monitor protein stability and integrity using techniques such as circular dichroism and fluorescence spectroscopy. Employ analytical SEC-MALS (size exclusion chromatography with multi-angle light scattering) to assess homogeneity and oligomeric state of the purified protein.

How can researchers validate the functional activity of recombinant ccsA?

Validating the functional activity of recombinant ccsA requires approaches that assess its role in cytochrome c maturation:

  • Complementation Assays:

    • Express recombinant ccsA in ccsA-deficient mutants

    • Measure restoration of cytochrome c maturation and associated phenotypes

    • Quantify cytochrome c levels using spectroscopic methods

  • In vitro Heme Transport/Attachment Assays:

    • Reconstitute purified ccsA into proteoliposomes

    • Monitor transport or facilitation of heme across the membrane using fluorescently labeled heme analogs

    • Measure heme attachment to apocytochrome c in coupled enzyme systems

  • Binding Assays:

    • Assess binding to interaction partners (e.g., cytochrome c, heme) using techniques like:

      • Surface plasmon resonance (SPR)

      • Isothermal titration calorimetry (ITC)

      • Microscale thermophoresis (MST)

  • Spectroscopic Analysis:

    • Circular dichroism to confirm proper folding

    • Fluorescence spectroscopy to monitor conformational changes upon substrate binding

Activity assays should include appropriate controls such as known inactive mutants (site-directed mutagenesis of conserved residues) and comparison to native protein where possible.

How can ccsA be utilized in cotton improvement programs?

The ccsA protein from G. barbadense can serve as both a marker and potential target in cotton improvement programs:

  • Marker-Assisted Selection:

    • Develop molecular markers based on ccsA sequence polymorphisms between cotton species

    • Use these markers to track the introgression of G. barbadense chromosomal segments into G. hirsutum backgrounds

    • Select for lines containing beneficial ccsA alleles that may contribute to improved fiber quality or stress resistance

  • Chromosome Substitution Studies:

    • Utilize chromosome substitution lines (CSLs) to identify chromosomal associations of ccsA with agronomic and fiber traits

    • Analyze the effects of specific G. barbadense chromosomal segments containing ccsA on phenotypic traits in a G. hirsutum background

    • Correlate ccsA variants with specific phenotypic outcomes in near-isogenic lines

  • Genetic Engineering Approaches:

    • Introduce optimized ccsA alleles from G. barbadense into other cotton species

    • Create knock-in/knock-out lines to evaluate the specific contribution of ccsA to fiber development and plant resistance

  • Integration with Breeding Programs:

    • Combine traditional breeding with molecular approaches targeting ccsA

    • Develop mapping populations specifically designed to elucidate the role of ccsA in improving fiber quality

Research on chromosome substitution lines has demonstrated that genes from G. barbadense can significantly impact agronomic and fiber traits when introduced into G. hirsutum backgrounds . The specific role of ccsA in these processes can be elucidated through targeted studies of lines containing the chromosomal segment where ccsA is located.

What role might ccsA play in G. barbadense's resistance to Fusarium and Verticillium wilts?

G. barbadense is well known for its high levels of resistance to Fusarium and Verticillium wilts, which are major cotton pathogens . The potential role of ccsA in this resistance involves several mechanisms:

  • Energy Metabolism Modulation:

    • As a component of the cytochrome c maturation pathway, ccsA influences cellular respiration efficiency

    • Enhanced energy production may support more robust defense responses

    • Altered electron transport chain activity could affect reactive oxygen species (ROS) production and signaling

  • Stress Response Coordination:

    • Cytochromes are involved in stress signaling pathways

    • Variants of ccsA might optimize stress response pathways specific to fungal pathogen recognition

    • Efficient cytochrome c maturation could enable rapid initiation of hypersensitive responses

  • Cell Death Regulation:

    • Cytochrome c release is a key step in programmed cell death pathways

    • ccsA variants may influence the threshold for initiating localized cell death in response to pathogen detection

    • Controlled cell death is critical for containing fungal spread while minimizing tissue damage

Experimental approaches to test these hypotheses would include:

  • Comparison of ccsA expression levels in resistant vs. susceptible cotton lines during pathogen challenge

  • Functional analysis of G. barbadense ccsA when expressed in susceptible cotton varieties

  • Targeted mutagenesis of ccsA to identify domains critical for resistance phenotypes

How does ccsA contribute to G. barbadense's superior fiber properties?

The connection between ccsA and G. barbadense's superior fiber properties involves complex metabolic and developmental pathways:

Fiber PropertyPotential ccsA ContributionMechanism
Fiber LengthSustained energy productionEnhanced ATP availability for cell elongation during fiber development
Fiber StrengthOptimized cell wall depositionEfficient energy metabolism supporting cellulose synthesis
Fiber FinenessRegulated secondary cell wall formationCoordinated developmental transitions mediated by energy-dependent signaling

Research on chromosome substitution lines has shown that specific chromosomal segments from G. barbadense can significantly impact fiber properties when introgressed into G. hirsutum . The presence of ccsA on these chromosomal segments suggests potential involvement in determining these traits.

Experimental evidence supporting ccsA's role in fiber development could be gathered through:

  • Temporal expression analysis of ccsA during fiber development stages

  • Comparison of ccsA activity in fiber cells of G. barbadense versus G. hirsutum

  • Correlation between ccsA allelic variants and specific fiber quality metrics

  • Functional analysis of ccsA in transgenic cotton with modified fiber properties

What common challenges arise in recombinant expression of G. barbadense ccsA and how can they be addressed?

Recombinant expression of membrane proteins like ccsA presents several specific challenges:

  • Low Expression Levels:

    • Challenge: Membrane proteins often express poorly compared to soluble proteins

    • Solution: Optimize codon usage, test different promoters (e.g., T7, tac, AOX1), and evaluate various expression temperatures (typically lower temperatures of 18-25°C slow expression and improve folding)

  • Protein Misfolding and Aggregation:

    • Challenge: Complex membrane topology leads to misfolding in heterologous systems

    • Solution: Use solubility-enhancing fusion partners (MBP, SUMO, Trx), screen multiple detergents for solubilization, and consider membrane-mimetic systems like nanodiscs

  • Protein Toxicity to Expression Host:

    • Challenge: Overexpression of membrane proteins can disrupt host membrane integrity

    • Solution: Use tightly controlled inducible expression systems, test expression in specialized host strains (C41/C43 for E. coli), and optimize induction conditions (lower inducer concentrations)

  • Improper Post-translational Modifications:

    • Challenge: Plant-specific modifications may be absent in bacterial systems

    • Solution: Consider eukaryotic expression systems (yeast, insect cells, plant cell cultures) for more native-like processing

  • Protein Instability:

    • Challenge: ccsA may be unstable when removed from its native membrane environment

    • Solution: Screen stabilizing additives (glycerol, specific lipids), optimize buffer conditions (pH, salt concentration), and consider protein engineering to remove unstable regions

Systematic optimization of these parameters is typically required, often using a design of experiments (DoE) approach to efficiently identify optimal conditions.

How can researchers address the challenges of studying membrane protein interactions of ccsA?

Studying membrane protein interactions presents unique challenges that require specialized approaches:

  • In vivo Interaction Analysis:

    • Split-ubiquitin yeast two-hybrid systems specifically designed for membrane proteins

    • Bimolecular fluorescence complementation (BiFC) in plant systems

    • FRET/FLIM microscopy with fluorescently tagged proteins

  • In vitro Interaction Analysis:

    • Co-purification strategies using tandem affinity tags

    • Reconstitution of interaction partners in nanodiscs or liposomes

    • Cross-linking mass spectrometry to identify interaction surfaces

  • Biophysical Characterization:

    • Microscale thermophoresis (MST) with detergent-solubilized proteins

    • Surface plasmon resonance (SPR) with captured protein in nanodiscs

    • Native mass spectrometry for intact membrane protein complexes

  • Computational Approaches:

    • Molecular docking simulations of ccsA with potential interaction partners

    • Molecular dynamics simulations in membrane environments

    • Evolutionary coupling analysis to predict interaction interfaces

A comprehensive interaction study would typically begin with computational predictions, followed by validation using multiple experimental techniques. When studying ccsA interactions with cytochrome c or other components of the cytochrome maturation system, it's essential to preserve the native membrane environment as much as possible.

How can genomic approaches advance our understanding of ccsA function in cotton improvement?

Advanced genomic approaches offer powerful tools for understanding ccsA function and its application in cotton improvement:

  • Comparative Genomics:

    • Analyze ccsA sequence and structural conservation across cotton species

    • Identify species-specific variations that correlate with fiber quality or disease resistance

    • Reconstruct evolutionary history of ccsA to understand selection pressures

  • Functional Genomics:

    • Apply CRISPR-Cas9 genome editing to create ccsA variants in cotton

    • Develop TILLING populations to identify natural ccsA mutations

    • Use RNA interference or virus-induced gene silencing to temporarily modulate ccsA expression

  • Association Mapping:

    • Perform genome-wide association studies (GWAS) to correlate ccsA polymorphisms with phenotypic traits

    • Develop high-density marker sets around the ccsA locus

    • Analyze chromosome segment substitution lines (CSSLs) to isolate ccsA effects

  • Transcriptomics and Proteomics:

    • Profile gene expression changes in plants with modified ccsA

    • Identify proteins that co-express or interact with ccsA

    • Compare proteome differences between G. barbadense and G. hirsutum focusing on cytochrome-related pathways

Recent research utilizing chromosome segment substitution lines has demonstrated the value of genomic approaches in identifying specific chromosomal segments from G. barbadense that confer advantageous traits when introgressed into G. hirsutum . These approaches can be refined to focus specifically on segments containing ccsA to determine its contribution to these traits.

What potential applications exist for recombinant ccsA in studying plant stress responses?

Recombinant ccsA offers valuable tools for studying plant stress responses:

  • Oxidative Stress Models:

    • Use purified ccsA to reconstruct in vitro systems for studying electron transport under stress conditions

    • Analyze how ccsA variants affect reactive oxygen species (ROS) generation and detoxification

    • Develop biosensors based on ccsA for monitoring cellular redox states

  • Pathogen Response Studies:

    • Investigate how ccsA function changes during pathogen challenge

    • Examine whether G. barbadense ccsA confers enhanced pathogen resistance when expressed in susceptible species

    • Utilize recombinant ccsA to study interactions with pathogen effector proteins

  • Abiotic Stress Applications:

    • Analyze ccsA's role in drought, heat, or salinity tolerance

    • Compare activity of ccsA from stress-tolerant vs. susceptible cotton varieties

    • Engineer optimized ccsA variants for improved stress tolerance

  • Systems Biology Integration:

    • Position ccsA within broader metabolic and signaling networks related to stress

    • Model how alterations in cytochrome c maturation affect whole-plant responses

    • Identify key control points where ccsA function influences stress outcomes

The high resistance of G. barbadense to Fusarium and Verticillium wilts suggests that components of its cellular machinery, potentially including ccsA, contribute to enhanced disease resistance. Further research on recombinant ccsA could elucidate the molecular mechanisms underlying this resistance.

How might bacterial artificial chromosome (BAC) libraries advance research on ccsA?

Bacterial artificial chromosome (BAC) libraries represent powerful genomic resources for advancing ccsA research:

  • Genomic Context Analysis:

    • Study the genomic environment surrounding ccsA in G. barbadense

    • Identify regulatory elements and other genes that may functionally interact with ccsA

    • Compare genomic organization across cotton species to understand evolutionary constraints

  • Functional Complementation:

    • Use BAC clones containing intact ccsA loci for plant transformation

    • Test whether the complete genomic region from G. barbadense confers enhanced traits

    • Study the effects of regulatory regions that may be absent in cDNA-based approaches

  • Structural Genomics:

    • Analyze chromosome architecture around the ccsA locus

    • Identify potential structural variations that affect ccsA expression

    • Study chromatin modifications in the ccsA region under different conditions

  • Resources for Breeding Programs:

    • Develop BAC-derived markers for tracking ccsA alleles in breeding populations

    • Create chromosome-specific libraries to facilitate targeted introgression

    • Use BAC sequences to design gene-editing approaches for ccsA modification

The construction of the first bacterial artificial chromosome (BAC) library for G. barbadense (containing 167,424 clones with an average insert size of 130 kb and representing 6.5-fold genome equivalents) provides a valuable resource for these approaches. This high-quality library enables the exploitation of genetic variation for cotton improvement, including detailed study of genes like ccsA.

What are the most promising research directions for G. barbadense ccsA in cotton improvement?

The most promising research directions for G. barbadense ccsA in cotton improvement include:

  • Integration with Chromosome Substitution Studies:

    • Utilize existing chromosome substitution lines to isolate and characterize the specific effects of chromosomal segments containing ccsA

    • Develop near-isogenic lines specifically targeting the ccsA locus

    • Correlate phenotypic effects with specific ccsA alleles

  • Functional Characterization in Diverse Genetic Backgrounds:

    • Express G. barbadense ccsA variants in multiple G. hirsutum backgrounds

    • Evaluate the consistency of effects across different genetic contexts

    • Identify genetic factors that interact with ccsA to modulate its effects

  • Application in Marker-Assisted Selection:

    • Develop high-resolution markers specific to beneficial ccsA alleles

    • Integrate ccsA-based selection into breeding programs targeting fiber quality and disease resistance

    • Create diagnostic tools for tracking G. barbadense introgressions containing ccsA

  • Precision Engineering Approaches:

    • Apply CRISPR-Cas9 to edit native ccsA in commercial cotton varieties

    • Test specific amino acid substitutions identified through comparative genomics

    • Engineer optimized promoters for tissue-specific or stress-responsive ccsA expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.