Recombinant Gossypium barbadense NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Basic Research Questions

• What is the basic structure and function of NAD(P)H-quinone oxidoreductase subunit 3 in G. barbadense?

  NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a 120-amino acid chloroplastic protein that functions as part of the NAD(P)H dehydrogenase complex. The full amino acid sequence is MFLLYEYDIFWAFLIISSAIPILAFLISGVLAPIRKGPEKLSSYESGIEPMGDAWLQFRIRYYMFALVFVVLDVETVFLYPWAMSFDVLGVPVFIEAFIFVLILIVGSVYAWRKGALEWS . This protein participates in electron transfer reactions, specifically in the reduction of quinones to hydroquinones using either NADH or NADPH as electron donors. The protein contains membrane-spanning domains and functions within the thylakoid membrane of chloroplasts, contributing to cyclic electron flow and ATP synthesis in photosynthetic processes .

• How does NAD(P)H-quinone oxidoreductase catalyze redox reactions?

  NAD(P)H-quinone oxidoreductase catalyzes a two-electron reduction of quinones and a wide variety of other organic compounds, avoiding the production of reactive semiquinones that can cause oxidative stress . The reaction mechanism follows a substituted enzyme (ping-pong) pattern:

  1. First, NADH or NADPH binds to the enzyme and reduces the enzyme-bound FAD cofactor

  2. The reduced enzyme then transfers electrons to the quinone substrate

  3. This two-electron transfer converts quinones directly to hydroquinones, bypassing the formation of semiquinone intermediates

  This process helps protect cells against oxidative stress by preventing the generation of reactive oxygen species that would otherwise occur through single-electron reduction pathways .

• What is the evolutionary significance of ndhC in Gossypium barbadense?

  The ndhC gene in G. barbadense has evolutionary significance in the context of chloroplast genome evolution within the Gossypium genus. Comparative analysis of chloroplast genomes between G. barbadense and other Gossypium species, such as G. hirsutum, reveals single-nucleotide polymorphisms (SNPs) in ndhC and other genes encoding components of NAD(P)H-quinone oxidoreductase . These genetic variations may contribute to differences in photosynthetic efficiency, stress responses, and possibly fiber development between cotton species. As G. barbadense serves as a model plant for studying polyploidization and evolution, understanding the evolutionary changes in ndhC can provide insights into chloroplast genome adaptation during cotton domestication and improvement .

Advanced Research Questions

• How does NAD(P)H-quinone oxidoreductase contribute to reactive oxygen species (ROS) metabolism in G. barbadense chloroplasts?

  NAD(P)H-quinone oxidoreductase plays a crucial role in regulating ROS metabolism in G. barbadense chloroplasts through several mechanisms:

  1. By catalyzing two-electron reduction of quinones, it prevents the formation of semiquinone radicals that can generate superoxide (O₂⁻) through auto-oxidation

  2. It contributes to maintaining cellular redox homeostasis by recycling NAD(P)H/NAD(P)⁺ ratios

  3. It influences electron flow in the photosynthetic electron transport chain, preventing over-reduction of electron carriers that can lead to ROS formation

  Research indicates that silencing of genes encoding components of the NAD(P)H-quinone oxidoreductase complex, including atpE and atpF, leads to significant accumulation of ROS (H₂O₂ and ¹O₂) in cotton leaves . Specifically, when atpE was silenced, O₂⁻ levels increased to 75.667 ± 1.453 μmol/g compared to 32.722 ± 5.134 μmol/g in control plants, while ¹O₂ increased to 19.635 ± 1.356 μmol/g compared to 4.235 ± 1.086 μmol/g in controls . These findings demonstrate the enzyme's importance in protecting chloroplasts from oxidative damage.

• What are the key differences in ndhC between G. barbadense and G. hirsutum that might contribute to their phenotypic differences?

  Comparative genomic analysis of G. barbadense and G. hirsutum chloroplast genomes has revealed specific differences in ndhC and other genes encoding components of NAD(P)H-quinone oxidoreductase. Table 5 from research comparing Jin A-CMS (containing G. hirsutum cytoplasmic background) with the reference G. hirsutum chloroplast genome sequence showed that ndhA has two amino acid differences: position 24 (Y to -) and position 122 (R to +) .

  While the specific differences in ndhC between the two species aren't detailed in the search results, research indicates that variations in chloroplast genes, including those encoding NAD(P)H-quinone oxidoreductase components, contribute to differences in:

  1. Redox homeostasis and ROS management

  2. Energy metabolism efficiency

  3. Stress response capabilities

  4. Fiber development processes

  These molecular differences may partly explain why G. barbadense produces superior quality fibers compared to G. hirsutum, as evidenced by multiple QTL studies showing differential gene expression at critical periods of fiber development (10 and 25 days post-anthesis) .

• What experimental approaches can be used to characterize the role of recombinant ndhC in ROS signaling pathways?

  To characterize the role of recombinant ndhC in ROS signaling pathways, researchers can employ several experimental approaches:

  1. Gene silencing approaches:

     • Virus-induced gene silencing (VIGS) using TRV vectors as demonstrated in studies with related genes (atpE, atpF)

     • CRISPR-Cas9 targeted mutagenesis for precise genetic modification

  2. ROS measurement techniques:

     • Nitroblue tetrazolium (NBT) staining for superoxide detection

     • 3,3'-diaminobenzidine (DAB) staining for hydrogen peroxide detection

     • Fluorescent probes (DCFH-DA, DHE) for quantitative ROS measurement

     • Electron paramagnetic resonance (EPR) spectroscopy for direct ROS detection

  3. Protein interaction studies:

     • Co-immunoprecipitation to identify protein partners

     • Yeast two-hybrid screening for interacting proteins

     • Bimolecular fluorescence complementation (BiFC) for in vivo interaction verification

  4. Transcriptomic and proteomic analyses:

     • RNA-seq to identify downstream genes affected by ndhC modulation

     • Proteomics to measure changes in protein abundance and post-translational modifications

  5. Physiological assays:

     • Photosynthetic efficiency measurements (chlorophyll fluorescence, P700 absorbance)

     • Electron transport rate determinations

     • ATP/NADPH ratio measurements

  Integrating these approaches would provide comprehensive insights into how ndhC influences ROS signaling networks in cotton.

Methodological Research Questions

• What expression systems are most effective for producing functional recombinant G. barbadense NAD(P)H-quinone oxidoreductase subunit 3?

  For producing functional recombinant G. barbadense NAD(P)H-quinone oxidoreductase subunit 3, the most effective expression system appears to be E. coli with a His-tag fusion. Based on the available research data:

  1. Bacterial expression systems:

     • E. coli has been successfully used to express the full-length protein (amino acids 1-120) with an N-terminal His-tag

     • The protein can be expressed in soluble form using Tris/PBS-based buffer with 6% trehalose at pH 8.0

  2. Expression vector considerations:

     • Vectors containing T7 or tac promoters for high-level expression

     • Inclusion of appropriate signal sequences if membrane localization is required

     • Codon optimization for E. coli may improve expression levels

  3. Purification strategy:

     • Immobilized metal affinity chromatography (IMAC) using the His-tag

     • Size exclusion chromatography for further purification

     • Buffer composition containing 50% glycerol for long-term storage

  4. Protein quality considerations:

     • Verification of purity through SDS-PAGE (>90% purity is achievable)

     • Confirmation of proper folding through activity assays

     • Stability assessment through freeze-thaw cycle testing

  For research requiring authentic post-translational modifications or membrane insertion, plant-based expression systems such as tobacco or Arabidopsis might be more appropriate, though these systems typically yield lower protein amounts.

• How can researchers optimize activity assays for NAD(P)H-quinone oxidoreductase from G. barbadense?

  Optimizing activity assays for NAD(P)H-quinone oxidoreductase from G. barbadense requires consideration of several parameters:

  1. Substrate selection:

     • Use appropriate quinone substrates such as methyl-1,4-benzoquinone or 9,10-phenanthrenequinone

     • Research indicates that this enzyme tends to catalyze larger substrates like 9,10-phenanthrenequinone more efficiently

  2. Cofactor considerations:

     • Test both NADH and NADPH as electron donors, as NAD(P)H-quinone oxidoreductases can typically use either cofactor

     • Optimize cofactor concentration (typically 100-500 μM)

  3. Assay conditions:

     • Buffer composition: Typically phosphate buffer (50-100 mM) at pH 7.4-7.8

     • Temperature: 25-30°C for optimal activity

     • Include appropriate controls (enzyme-free, substrate-free, cofactor-free)

  4. Detection methods:

     • Spectrophotometric monitoring of NAD(P)H oxidation at 340 nm

     • Monitoring quinone reduction directly at appropriate wavelengths

     • For complex mixtures, HPLC or LC-MS methods for product detection

  5. Data analysis:

     • Calculate kinetic parameters (Km, Vmax) using Michaelis-Menten or Lineweaver-Burk plots

     • Determine enzyme-specific activity (μmol product/min/mg protein)

     • Assess inhibition patterns if studying modulators

  When investigating the role of specific amino acid residues in catalysis, site-directed mutagenesis combined with activity assays can provide valuable insights, as demonstrated in similar studies with quinone oxidoreductases .

• What computational approaches are useful for predicting the structure and functional domains of G. barbadense ndhC?

  Computational approaches for predicting the structure and functional domains of G. barbadense ndhC include:

  1. Sequence analysis tools:

     • Multiple sequence alignment with homologous proteins using CLUSTAL Omega or MUSCLE

     • Conservation analysis to identify functionally important residues

     • Motif identification using PROSITE or MEME

  2. Structure prediction methods:

     • Homology modeling based on crystal structures of related quinone oxidoreductases

     • Ab initio structure prediction using Rosetta or I-TASSER

     • Prediction of membrane-spanning regions using TMHMM or Phobius

  3. Functional domain analysis:

     • InterProScan for domain identification

     • Conserved Domain Database (CDD) search for functional annotation

     • SMART analysis for identification of signaling domains

  4. Molecular dynamics simulations:

     • Simulation of protein-membrane interactions

     • Analysis of cofactor binding dynamics

     • Prediction of conformational changes during catalysis

  5. Protein-substrate interaction prediction:

     • Molecular docking to identify potential quinone binding sites

     • Computational analysis of electrostatic surface potential

     • Virtual screening of potential substrate molecules

  Research on quinone oxidoreductases has demonstrated that computational simulation combined with site-directed mutagenesis and enzymatic activity assays can effectively define potential quinone-binding sites and elucidate catalytic mechanisms .

Comparative Research Questions

• How does the function of ndhC differ between G. barbadense and other plants in stress response mechanisms?

  The function of ndhC in G. barbadense compared to other plants reveals distinct roles in stress response mechanisms:

  1. Role in ROS management:

     • In G. barbadense, ndhC appears to be particularly important in ROS homeostasis, with SNPs in this gene potentially contributing to the plant's stress tolerance

     • Research has shown that genes encoding components of NAD(P)H-quinone oxidoreductase complexes impact ROS accumulation, which is critical during stress responses

  2. Drought and heat stress responses:

     • G. barbadense has superior drought tolerance compared to many other cotton species, potentially linked to more efficient NAD(P)H-quinone oxidoreductase function

     • The enzyme's role in maintaining electron flow during stress conditions helps prevent photoinhibition and oxidative damage

  3. Pathogen resistance mechanisms:

     • G. barbadense cultivars like Hai7124 show enhanced resistance to Verticillium wilt compared to G. hirsutum TM-1

     • NAD(P)H-quinone oxidoreductase may contribute to this resistance by regulating ROS-mediated defense signaling

     • NLR genes that respond to pathogen invasion are induced earlier and more strongly in resistant G. barbadense than in G. hirsutum

  4. Evolutionary adaptations:

     • Comparative genomic analyses indicate that chloroplast genes, including those encoding NAD(P)H-quinone oxidoreductase components, have undergone selection during domestication

     • These adaptations likely contribute to enhanced stress tolerance in specific environments

  The divergent stress response mechanisms between G. barbadense and other plants highlight the importance of species-specific studies when investigating NAD(P)H-quinone oxidoreductase functions.

• What role does NAD(P)H-quinone oxidoreductase play in fiber development of G. barbadense compared to other cotton species?

  NAD(P)H-quinone oxidoreductase plays a multifaceted role in fiber development of G. barbadense compared to other cotton species:

  1. Redox regulation during fiber elongation:

     • G. barbadense produces superior quality fibers with enhanced length and strength compared to G. hirsutum

     • NAD(P)H-quinone oxidoreductase contributes to redox homeostasis, which influences fiber cell elongation and secondary wall deposition

     • Research has shown that hydrogen peroxide and other ROS are important for fiber initiation and elongation

  2. Differential expression patterns:

     • Fiber development shows greatest differences between G. barbadense and G. hirsutum at 10 and 25 days post-anthesis (DPA)

     • These periods correspond to critical phases of fiber elongation and secondary cell wall biosynthesis

     • Expression quantitative trait loci (eQTL) analyses have identified 916 eQTL significantly affecting the expression of 394 differential genes between these species

  3. Cell wall development regulation:

     • NAD(P)H-quinone oxidoreductase may influence cell wall biosynthesis through its effects on redox status and energy metabolism

     • Studies have shown that "domestication appeared to enhance modulation of cellular redox levels" in cultivated G. barbadense compared to wild varieties

     • The cultivar "prolonged fiber growth with up-regulation of signal transduction and hormone-signaling genes and down-regulation of cell wall maturation genes"

  4. Species-specific genetic factors:

     • Comparative transcriptome analyses between G. barbadense and G. hirsutum revealed that "secondary metabolism, pectin synthesis, and pectin modification genes were the most statistically significant and differentially expressed categories between the two species"

     • These differences suggest that NAD(P)H-quinone oxidoreductase may interact with species-specific metabolic networks to influence fiber development

  Understanding these species-specific differences provides valuable insights for cotton improvement programs aiming to enhance fiber quality traits.

• How does the chloroplastic localization of NAD(P)H-quinone oxidoreductase affect its function compared to cytosolic variants?

  The chloroplastic localization of NAD(P)H-quinone oxidoreductase significantly affects its function compared to cytosolic variants in several critical ways:

  1. Integration with photosynthetic electron transport:

     • The chloroplastic NAD(P)H-quinone oxidoreductase subunit 3 functions within the thylakoid membrane, directly interfacing with photosynthetic electron transport chains

     • This positioning allows it to participate in cyclic electron flow around photosystem I, which enhances ATP production without net NADPH oxidation

     • Cytosolic variants lack this direct connection to photosynthetic processes

  2. Substrate accessibility differences:

     • Chloroplastic variants have access to plastoquinone and other photosynthetic electron carriers as substrates

     • Cytosolic variants interact with different quinone substrates present in the cytoplasm

     • The substrate preference for larger quinones like 9,10-phenanthrenequinone may reflect adaptations to chloroplast-specific electron carriers

  3. Contribution to energy balance:

     • Chloroplastic NAD(P)H-quinone oxidoreductase helps maintain appropriate ATP/NADPH ratios for carbon fixation

     • Its role in cyclic electron flow becomes especially important under stress conditions when linear electron flow is impaired

     • Research has shown that "ATP synthase genes atpE and atpF regulate energy metabolism through changes at the transcriptional level" , suggesting coordination between NAD(P)H-quinone oxidoreductase and ATP synthesis

  4. Involvement in retrograde signaling:

     • Chloroplastic NAD(P)H-quinone oxidoreductase likely participates in retrograde signaling from chloroplast to nucleus

     • Changes in its activity can influence nuclear gene expression patterns related to photosynthesis and stress responses

     • This signaling role is absent in cytosolic variants

  5. ROS management specificity:

     • Chloroplastic NAD(P)H-quinone oxidoreductase specifically protects photosynthetic apparatus from ROS damage

     • It helps prevent photoinhibition during high light conditions

     • Gene silencing experiments showed that when components of the photosynthetic electron transport chain were disrupted, ROS levels increased significantly in chloroplasts

  These functional differences highlight the specialized role of chloroplastic NAD(P)H-quinone oxidoreductase in coordinating energy metabolism and redox balance within the unique biochemical environment of the chloroplast.