Recombinant Gossypium barbadense NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Gossypium barbadense (Sea-island cotton) (Egyptian cotton)
Target Names
ndhE
Target Protein Sequence
MMLEHIPVLSAYLFSIDIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDSRQLKGN IFSIFVIAIAAAEAAIGSAIVSSIYRNRKSTRINQSTLLNK
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be plastoquinone. This process couples the redox reaction to proton translocation, conserving the redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does chloroplastic NAD(P)H-quinone oxidoreductase differ from cytosolic variants?

The chloroplastic NAD(P)H-quinone oxidoreductase, such as the subunit 4L from Gossypium barbadense, differs from cytosolic variants in several important ways:

  • Subcellular localization: The chloroplastic variant localizes to plastoglobules (lipid droplets within chloroplasts) where it associates with the prenylquinone metabolism pathway .

  • Substrate specificity: While cytosolic NAD(P)H:quinone oxidoreductase (like NQO1) typically acts on a broad range of quinones, the chloroplastic variant has higher specificity for plastoquinone and related plastidial quinones .

  • Physiological role: Chloroplastic variants are critically involved in prenylquinone metabolism and vitamin K1 accumulation, whereas cytosolic variants primarily function in general detoxification pathways .

  • Structural features: The chloroplastic variant contains transit peptides for chloroplast targeting and has structural adaptations for functioning in the unique lipid environment of plastoglobules.

What are the recommended protocols for measuring NAD(P)H-quinone oxidoreductase activity in plant extracts?

NAD(P)H-quinone oxidoreductase activity can be reliably measured using spectrophotometric assays that monitor the oxidation of NADH to NAD+ at 340 nm. The following protocol is recommended:

  • Sample preparation:

    • Harvest fresh plant tissue and homogenize in ice-cold buffer (typically 50 mM Tris-HCl pH 7.5, 1 mM EDTA, 1 mM DTT, and protease inhibitors).

    • Use physical disruption methods (e.g., Bead Beater or French Press) rather than chemical methods which may inactivate the enzyme .

    • Centrifuge the homogenate at 15,000g for 15 minutes at 4°C and collect the supernatant.

  • Activity assay:

    • Prepare reaction mixture containing buffer, cell extract, and an appropriate quinone substrate (e.g., decyl-plastoquinone or menadione).

    • Set up appropriate blank controls without enzyme or substrate.

    • Add NADH (final concentration 0.1-0.2 mM) to initiate the reaction.

    • Monitor the decrease in absorbance at 340 nm over 60-120 seconds .

    • Calculate activity using the extinction coefficient of NADH (6,220 M⁻¹cm⁻¹).

For enhanced sensitivity, coupling enzymes may be employed, but it's essential to maintain much higher activities of coupling enzymes (>200-fold) than that of NAD(P)H-quinone oxidoreductase to ensure accurate measurements .

How can researchers optimize the expression of recombinant Gossypium barbadense NAD(P)H-quinone oxidoreductase subunit 4L?

Optimizing expression of recombinant G. barbadense NAD(P)H-quinone oxidoreductase subunit 4L requires careful consideration of several factors:

  • Expression system selection:

    • Prokaryotic systems (E. coli): Use BL21(DE3) or Rosetta strains for efficient expression.

    • Eukaryotic systems: Consider yeast (S. cerevisiae or P. pastoris) for better post-translational modifications.

    • Plant expression systems: For authentic processing and targeting, consider transient expression in Nicotiana benthamiana.

  • Vector design:

    • For chloroplastic proteins, consider whether to include or exclude the transit peptide depending on the expression system.

    • Optimize codon usage for the host expression system.

    • Include appropriate tags (His, GST, MBP) to facilitate purification while minimizing impact on activity.

  • Expression conditions:

    • Temperature: Lower temperatures (16-25°C) often improve folding of plant proteins.

    • Induction parameters: Optimize inducer concentration and induction time.

    • Media composition: Supplement with cofactors like riboflavin or FMN if necessary.

  • Purification strategy:

    • For membrane-associated proteins from plastoglobules, use mild detergents (0.1-0.5% Triton X-100 or n-dodecyl-β-D-maltoside).

    • Consider stepwise purification combining affinity chromatography with ion exchange or size exclusion.

Expression SystemAdvantagesDisadvantagesTypical Yield (mg/L)
E. coliRapid, inexpensive, high yieldPotential improper folding, lack of post-translational modifications10-50
Yeast (P. pastoris)Better folding, some post-translational modificationsLonger process, more complex media5-20
Plant-based (N. benthamiana)Authentic processingLow yield, labor intensive0.5-5

What are the critical factors in designing kinetic studies for NAD(P)H-quinone oxidoreductase?

When designing kinetic studies for NAD(P)H-quinone oxidoreductase, researchers should consider:

  • Substrate selection:

    • Natural substrates: Plastoquinone for chloroplastic variants.

    • Analog substrates: Decyl-plastoquinone offers improved solubility for in vitro studies .

    • Alternative substrates: Menadione or ubiquinone analogs can provide comparative kinetic data .

  • Reaction conditions optimization:

    • pH optimization: Test activity across pH range 6.0-8.5.

    • Temperature effects: Measure activity at multiple temperatures (20-40°C).

    • Buffer composition: Test different buffers (Tris, phosphate, HEPES) for optimal activity.

  • Enzyme concentration determination:

    • Ensure linearity of reaction rates with enzyme concentration.

    • Determine protein concentration accurately using Bradford or BCA assays.

  • Data collection for kinetic parameters:

    • Vary substrate concentrations across a wide range (0.1-10x Km).

    • Measure initial rates before substrate depletion becomes significant (<10% conversion).

    • Include necessary controls for background NADH oxidation.

  • Inhibition studies:

    • Test known inhibitors like diphenyleneiodonium (DPI) and determine IC50 values .

    • Analyze inhibition patterns (competitive, non-competitive, uncompetitive).

For accurate determination of Km and Vmax values, use non-linear regression analysis of the Michaelis-Menten equation rather than linearization methods. For the chloroplastic NAD(P)H-quinone oxidoreductase with decyl-plastoquinone as substrate, typical values are Km ≈ 9 μM and Vmax ≈ 46 μmol/mg per min .

How does the redox status of NAD(P)H-quinone oxidoreductase affect plastoquinone metabolism in chloroplasts?

The chloroplastic NAD(P)H quinone oxidoreductase (NDC1) functions in a unique pathway of nonphotochemical plastoquinone reduction that operates parallel to cyclic and chlororespiratory electron flow . When NAD(P)H-quinone oxidoreductase activity is diminished or absent, the plastoquinone pool becomes significantly more oxidized, as observed in ndc1 mutants .

This redox regulation has multiple consequences:

  • Antioxidant function: The reduced plastoquinone serves as a lipid antioxidant in thylakoid membranes, protecting against oxidative damage.

  • Metabolic regulation: The redox state of the plastoquinone pool influences the accumulation of other prenylquinones, including plastochromanol-8 and phylloquinone (vitamin K1) .

  • Signaling: Changes in the plastoquinone redox state can trigger retrograde signaling from the chloroplast to the nucleus, affecting nuclear gene expression.

The bi-directional movement of plastoquinone between plastoglobules and thylakoid membranes is crucial for this regulatory function, with physical connections observed between the outer lipid leaflet of thylakoid membranes and the plastoglobule polar lipid monolayer .

What structural and functional differences exist between NAD(P)H-quinone oxidoreductase variants across plant species?

NAD(P)H-quinone oxidoreductase exhibits significant structural and functional diversity across plant species, reflecting adaptation to different ecological niches and metabolic requirements:

  • Domain architecture and active site composition:

    • Most plant NAD(P)H-quinone oxidoreductases contain conserved FAD-binding domains.

    • The substrate-binding pocket shows species-specific variations that influence quinone selectivity.

    • Cotton (Gossypium) species may have unique residues that optimize function in fiber-producing tissues.

  • Subcellular targeting and membrane association:

    • Transit peptide sequences vary considerably between species, affecting targeting efficiency.

    • Membrane-binding domains show adaptation to different lipid compositions in plastid membranes.

  • Catalytic efficiency and substrate preference:

    • C3 vs. C4 plants show adaptations in NAD(P)H-quinone oxidoreductase kinetics reflecting their photosynthetic metabolism.

    • Species from high-light environments often have enhanced capacity for quinone reduction.

  • Redox partner interactions:

    • Variations in surface-exposed residues affect interactions with electron donors and regulatory proteins.

    • Co-evolution with species-specific redox partners is observed.

  • Stress response adaptation:

    • Desert-adapted species show enhanced thermostability of NAD(P)H-quinone oxidoreductase.

    • Cold-adapted species exhibit modifications for activity at lower temperatures.

Understanding these differences is critical for interpreting experimental results across species and for engineering optimized variants for specific applications.

How does NAD(P)H-quinone oxidoreductase contribute to oxidative stress tolerance in Gossypium barbadense?

NAD(P)H-quinone oxidoreductase contributes significantly to oxidative stress tolerance in Gossypium barbadense through several interconnected mechanisms:

  • Direct quinone detoxification:

    • The enzyme reduces potentially harmful quinones that could otherwise participate in redox cycling and generate reactive oxygen species (ROS) .

    • This detoxification is particularly important during environmental stress when quinone production increases.

  • Maintenance of cellular redox balance:

    • By oxidizing NAD(P)H, the enzyme helps regulate the ratio of reduced to oxidized pyridine nucleotides, which is critical for cellular redox homeostasis .

    • Loss of this activity can lead to accumulation of NAD(P)H and disruption of redox-dependent processes .

  • Protection of chloroplast function:

    • The chloroplastic variant specifically maintains the reduced state of the plastoquinone pool, which serves as an antioxidant in thylakoid membranes .

    • This protection is crucial for preserving photosynthetic capacity during stress conditions.

  • Support for prenylquinone biosynthesis:

    • The enzyme is essential for normal accumulation of plastochromanol-8 and vitamin K1, which have antioxidant functions .

    • These compounds provide additional protection against lipid peroxidation in chloroplast membranes.

  • Influence on stress signaling pathways:

    • Changes in the redox state of the plastoquinone pool affect retrograde signaling from chloroplasts to the nucleus.

    • This signaling modulates the expression of stress-responsive genes to enhance tolerance.

This multifaceted role in stress protection makes NAD(P)H-quinone oxidoreductase a valuable target for improving stress tolerance in cotton and other crops.

What statistical approaches are most appropriate for analyzing NAD(P)H-quinone oxidoreductase activity data?

  • Descriptive statistics:

    • Central tendency: Report mean, median for activity measurements.

    • Dispersion: Include standard deviation, standard error, and coefficient of variation.

    • Data visualization: Use box plots or violin plots to display distribution of activity data.

  • Inferential statistics for comparing conditions:

    • For normally distributed data: t-tests (paired or unpaired) for two conditions; ANOVA for multiple conditions followed by post-hoc tests (Tukey's HSD, Bonferroni correction).

    • For non-normally distributed data: Mann-Whitney U test (two conditions) or Kruskal-Wallis test (multiple conditions).

    • For repeated measurements: Repeated measures ANOVA or mixed-effects models.

  • Regression analysis for kinetic data:

    • Non-linear regression for Michaelis-Menten kinetics to determine Km and Vmax.

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf plots as visual aids but not for primary parameter estimation.

    • Global curve fitting for inhibition studies to determine inhibition constants.

  • Multivariate analysis for complex datasets:

    • Principal component analysis (PCA) to identify patterns across multiple variables.

    • Hierarchical clustering to group similar samples or experimental conditions.

    • Partial least squares discriminant analysis (PLS-DA) to identify variables that discriminate between groups.

  • Statistical power considerations:

    • Conduct power analysis to determine appropriate sample sizes.

    • Report effect sizes along with p-values to indicate biological significance.

    • Consider using confidence intervals to express uncertainty in measurements.

For enzyme activity measurements specifically, a minimum of 3-5 biological replicates and 2-3 technical replicates is recommended. When comparing activities across different conditions, normalize to protein concentration and include appropriate controls in each experiment.

How can researchers interpret changes in NAD(P)H-quinone oxidoreductase expression under different stress conditions?

Interpreting changes in NAD(P)H-quinone oxidoreductase expression under different stress conditions requires a systematic approach:

  • Expression level interpretation:

    • Upregulation: Often indicates increased demand for quinone reduction and detoxification .

    • Downregulation: May reflect resource allocation away from normal metabolism toward specialized stress responses.

    • No change in expression but increased activity: Suggests post-translational modification or altered cofactor availability.

  • Temporal dynamics analysis:

    • Early response (minutes to hours): Usually indicates direct stress response.

    • Intermediate response (hours to days): May represent acclimation processes.

    • Late response (days to weeks): Often reflects long-term adaptation.

  • Tissue-specific patterns:

    • Differential regulation between tissues suggests specialized roles in stress response.

    • Coordinate regulation across tissues indicates systemic responses.

  • Correlation with other stress markers:

    • Positive correlation with antioxidant enzymes suggests coordinated ROS defense.

    • Correlation with specific metabolites can indicate pathway-level responses.

  • Comparison across stress types:

    • Stress-specific changes suggest specialized functions.

    • Common responses across multiple stresses indicate core protective roles.

For example, treatment with menadione (a quinone that can generate oxidative stress) has been shown to increase NAD(P)H:quinone oxidoreductase activity in cellular extracts . This increased activity could be due to elevated enzyme levels, enhanced enzymatic activity through post-translational modifications, or a combination of both mechanisms .

Stress ConditionExpression ChangeActivity ChangePossible Interpretation
High light↑↑↑↑↑Increased demand for plastoquinone reduction and ROS protection
Drought↑/→Moderate induction with potential post-translational inhibition
ColdMaintained expression but reduced activity due to temperature effects
Pathogen attack↑↑↑↑↑Strong induction with potential for specialized defense roles

What approaches can be used to analyze the interaction between NAD(P)H-quinone oxidoreductase and the plastoquinone pool in vivo?

Analyzing the interaction between NAD(P)H-quinone oxidoreductase and the plastoquinone pool in vivo requires specialized approaches that can capture the dynamic redox relationships in intact systems:

  • In vivo plastoquinone redox state measurement:

    • Chlorophyll fluorescence techniques to indirectly assess plastoquinone redox state.

    • Pulse amplitude modulation (PAM) fluorometry to determine photosystem II quantum yield, which reflects plastoquinone redox state.

    • Rapid extraction and HPLC analysis to directly measure reduced/oxidized plastoquinone ratios .

  • Genetic manipulation approaches:

    • Gene knockout/knockdown to observe effects of reduced NAD(P)H-quinone oxidoreductase activity on plastoquinone pool redox state .

    • Overexpression studies to determine if increased enzyme levels enhance plastoquinone reduction.

    • Site-directed mutagenesis of catalytic residues to create variants with altered activity.

  • Metabolic flux analysis:

    • Isotope labeling to track electron flow through the NAD(P)H-quinone oxidoreductase pathway.

    • Metabolic control analysis to quantify the control coefficient of the enzyme over plastoquinone redox state.

    • Integration of flux data with kinetic models of electron transport.

  • High-resolution imaging and localization:

    • Fluorescence resonance energy transfer (FRET) between labeled NAD(P)H-quinone oxidoreductase and plastoquinone analogs.

    • Super-resolution microscopy to visualize enzyme-substrate interactions in plastoglobules.

    • Correlative light and electron microscopy to relate enzyme localization to ultrastructural features.

  • Physiological response integration:

    • Measurement of photosynthetic parameters in response to altered NAD(P)H-quinone oxidoreductase activity.

    • ROS detection methods (e.g., H2DCF-DA fluorescence, EPR spectroscopy) to correlate plastoquinone redox state with oxidative stress.

    • Transcriptomic analysis to identify genes responding to changes in plastoquinone redox signaling.

Research has shown that the PQ pool is significantly more oxidized in ndc1 mutants than in wild-type plants, indicating that NAD(P)H-quinone oxidoreductase plays a crucial role in maintaining the reduced state of the plastoquinone pool . Furthermore, purified plastoglobules can function as a quinone-containing substrate, accepting electrons from NADPH and recombinant NAD(P)H-quinone oxidoreductase in vitro , demonstrating the direct relationship between the enzyme and its substrate pool.

What are the promising applications of engineered NAD(P)H-quinone oxidoreductase variants in improving crop stress tolerance?

Engineered NAD(P)H-quinone oxidoreductase variants offer several promising avenues for improving crop stress tolerance, particularly in economically important species like Gossypium barbadense:

  • Enhanced oxidative stress protection:

    • Engineering variants with improved catalytic efficiency could enhance detoxification of reactive quinones.

    • Modifying substrate specificity could target specific stress-induced quinones.

    • Creating variants with increased thermal stability could maintain protection under heat stress.

  • Optimized plastoquinone pool management:

    • Engineering variants that maintain optimal plastoquinone redox state under stress conditions.

    • Creating variants that respond more rapidly to changes in redox conditions.

    • Developing variants that protect photosynthetic efficiency during stress episodes.

  • Targeted subcellular protection:

    • Modifying targeting sequences to direct the enzyme to multiple cellular compartments beyond chloroplasts.

    • Creating dual-targeted variants that protect both chloroplasts and mitochondria.

    • Engineering variants with enhanced membrane association for improved protection of cellular membranes.

  • Stress-inducible expression systems:

    • Developing synthetic promoters that upregulate NAD(P)H-quinone oxidoreductase specifically under stress conditions.

    • Creating feedback-regulated systems that respond to quinone levels or redox imbalance.

    • Designing tissue-specific expression systems targeting vulnerable tissues.

  • Pathway integration:

    • Engineering coordinated expression with other antioxidant enzymes.

    • Creating variants that enhance vitamin K1 and plastochromanol-8 accumulation for additional stress protection .

    • Developing systems that link NAD(P)H-quinone oxidoreductase activity to broader stress signaling networks.

The development of these engineered variants would benefit from integrating insights from natural variation in NAD(P)H-quinone oxidoreductase across plant species adapted to different stress environments. The recombinant inbred mapping populations developed in Gossypium barbadense offer an excellent resource for identifying natural variants with enhanced stress tolerance properties .

How might NAD(P)H-quinone oxidoreductase function be integrated into systems biology models of chloroplast metabolism?

Integrating NAD(P)H-quinone oxidoreductase function into systems biology models of chloroplast metabolism requires a multi-scale approach that captures both the specific enzymatic reactions and their broader impacts on cellular physiology:

  • Kinetic modeling integration:

    • Incorporate enzyme kinetic parameters (Km, Vmax, inhibition constants) into existing models of chloroplast electron transport .

    • Model the dynamic regulation of enzyme activity in response to redox status and metabolite levels.

    • Account for substrate availability in different chloroplast compartments (plastoglobules vs. thylakoid membranes) .

  • Metabolic network integration:

    • Connect NAD(P)H-quinone oxidoreductase activity to NAD(P)H/NAD(P)+ ratios in chloroplast stroma.

    • Link plastoquinone reduction to broader prenylquinone metabolism pathways.

    • Incorporate the impact on vitamin K1 and plastochromanol-8 biosynthesis .

  • Multi-compartment modeling:

    • Model the movement of quinones between plastoglobules and thylakoid membranes .

    • Account for spatial constraints on enzyme-substrate interactions.

    • Incorporate the impact of membrane organization on enzyme function.

  • Regulatory network integration:

    • Model retrograde signaling triggered by changes in plastoquinone redox state.

    • Incorporate transcriptional and post-translational regulation of NAD(P)H-quinone oxidoreductase.

    • Include feedback loops between enzyme activity and expression of related genes.

  • Stress response integration:

    • Model the dynamics of enzyme function under different stress scenarios.

    • Incorporate crosstalk between chloroplast redox status and cellular stress responses.

    • Predict emergent properties of the system under fluctuating environmental conditions.

Such integrated models would enable prediction of system-level outcomes from molecular-level perturbations, guiding both basic research and applied efforts to improve crop performance. The models could be validated using data from mutants like the ndc1 knockout, which shows specific alterations in plastoquinone redox state and prenylquinone metabolism .

What techniques are emerging for studying the structural dynamics of NAD(P)H-quinone oxidoreductase during catalysis?

Emerging techniques for studying the structural dynamics of NAD(P)H-quinone oxidoreductase during catalysis offer unprecedented insights into the enzyme's mechanism:

  • Time-resolved structural methods:

    • Time-resolved X-ray crystallography using X-ray free-electron lasers (XFELs) to capture intermediate states.

    • Time-resolved cryo-electron microscopy (cryo-EM) to visualize conformational changes during the catalytic cycle.

    • Serial crystallography at synchrotrons to build movies of enzyme action.

  • Advanced spectroscopic approaches:

    • Time-resolved FTIR spectroscopy to track changes in protein secondary structure during catalysis.

    • Electron paramagnetic resonance (EPR) spectroscopy to follow the electronic states of FAD cofactor and quinone substrates.

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with altered solvent accessibility during the reaction.

  • Single-molecule techniques:

    • Single-molecule FRET to observe conformational dynamics in real-time.

    • Atomic force microscopy (AFM) with functionalized tips to measure enzyme-substrate interactions.

    • Optical tweezers combined with fluorescence to correlate mechanical changes with chemical steps.

  • Computational approaches:

    • Quantum mechanics/molecular mechanics (QM/MM) simulations to model electron transfer events.

    • Molecular dynamics simulations with enhanced sampling to identify conformational changes.

    • Machine learning approaches to identify patterns in structural data and predict functional states.

  • In-cell structural biology:

    • In-cell NMR to study enzyme dynamics in a native-like environment.

    • Cryo-electron tomography to visualize the enzyme in its natural cellular context.

    • Optogenetic approaches to trigger catalysis and monitor structural changes in living cells.

These techniques can reveal how NAD(P)H-quinone oxidoreductase undergoes conformational changes during its ping-pong reaction mechanism , how it interacts with membrane surfaces in plastoglobules , and how these dynamics are altered by changes in redox conditions or the presence of inhibitors like diphenyleneiodonium (DPI) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.